Property Summary

NCBI Gene PubMed Count 42
PubMed Score 26.02
PubTator Score 29.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Prostate cancer 175 0.0 3.0
Disease Target Count Z-score Confidence
Lethal midline granuloma 6 3.711 1.9
Multiple Sclerosis 540 3.567 1.8

Gene RIF (27)

AA Sequence

MTPILTVLICLGLSLDPRTHVQAGPLPKPTLWAEPGSVITQGSPVTLRCQGSLETQEYHLYREKKTALWI      1 - 70
TRIPQELVKKGQFPILSITWEHAGRYCCIYGSHTAGLSESSDPLELVVTGAYSKPTLSALPSPVVTSGGN     71 - 140
VTIQCDSQVAFDGFILCKEGEDEHPQCLNSHSHARGSSRAIFSVGPVSPSRRWSYRCYGYDSRAPYVWSL    141 - 210
PSDLLGLLVPGVSKKPSLSVQPGPVVAPGEKLTFQCGSDAGYDRFVLYKEWGRDFLQRPGRQPQAGLSQA    211 - 280
NFTLGPVSRSYGGQYTCSGAYNLSSEWSAPSDPLDILITGQIRARPFLSVRPGPTVASGENVTLLCQSQG    281 - 350
GMHTFLLTKEGAADSPLRLKSKRQSHKYQAEFPMSPVTSAHAGTYRCYGSLSSNPYLLTHPSDPLELVVS    351 - 420
GAAETLSPPQNKSDSKAGE                                                       421 - 439
//

Text Mined References (43)

PMID Year Title