Property Summary

NCBI Gene PubMed Count 38
Grant Count 2
Funding $54,901
PubMed Score 25.99
PubTator Score 29.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Synonym

Accession Q8N6C8 J3KPM2 O15469 O15470 O75016 Q8N151 Q8N154 Q8NHJ1 Q8NHJ2 Q8NHJ3 Q8NHJ4
Symbols HM31
HM43
ILT6
LIR4
CD85E
ILT-6
LIR-4

Gene

 Grant Application (2)

PDB

3Q2C  

Gene RIF (23)

PMID Text
26969150 Experiments point towards a beneficial role for LILRA3 in virus infections, especially in ssRNA viruses, like HIV, that engage TLR8; however, the potentially beneficial role of LILRA3 is abrogated during a HIV infection.
26871720 LILRA3 gene deletion was not associated with Multiple Sclerosis susceptibility and did not affect the age of disease onset, clinical subtype or disease severity.
26274821 Evidence showed lack of significant association between LILRA3 deletion and multiple sclerosis pathogenesis. [meta-analysis]
24906639 LILRA3 is a new susceptibility factor for systemic lupus erythematosus (SLE) and primary Sjogren's syndrome (pSS). It predisposes to certain phenotypes such as leucopenia, thrombocytopenia, autoantibody positivity and increased disease activity.
24899637 ILT6 deletion polymorphism does not appear to be a lupus susceptibility gene in South Indian Tamils, but may behave as a genetic modifier of autoantibody phenotype by influencing the production of anti-Ro60 and anti-Ro52 autoantibodies
24757135 functional LILRA3 is a novel genetic risk factor for rheumatoid arthritis (RA), especially in males. It appears to highly predispose to ACPA-positive RA and confers an increased risk of disease severity in patients with early RA.
24363809 LILRA3 is an immunostimulatory molecule, whose deficiency is associated with higher frequency of B-non-Hodgkin's lymphoma.
23615473 The current study was conducted to investigate the association of rs103294 of LILRA3 with benign prostatic hyperplasia risk.
23238213 Data did not indicate any association of LILRA3 deletion with multiple sclerosis (MS) susceptibility, however, patients negative for the deletion may begin to suffer from MS significantly earlier than patients who are positive.
21559424 LILRA3 binds both classical and non-classical HLA class I molecules but with reduced affinities compared to LILRB1/LILRB2
More...

AA Sequence

MTPILTVLICLGLSLDPRTHVQAGPLPKPTLWAEPGSVITQGSPVTLRCQGSLETQEYHLYREKKTALWI      1 - 70
TRIPQELVKKGQFPILSITWEHAGRYCCIYGSHTAGLSESSDPLELVVTGAYSKPTLSALPSPVVTSGGN     71 - 140
VTIQCDSQVAFDGFILCKEGEDEHPQCLNSHSHARGSSRAIFSVGPVSPSRRWSYRCYGYDSRAPYVWSL    141 - 210
PSDLLGLLVPGVSKKPSLSVQPGPVVAPGEKLTFQCGSDAGYDRFVLYKEWGRDFLQRPGRQPQAGLSQA    211 - 280
NFTLGPVSRSYGGQYTCSGAYNLSSEWSAPSDPLDILITGQIRARPFLSVRPGPTVASGENVTLLCQSQG    281 - 350
GMHTFLLTKEGAADSPLRLKSKRQSHKYQAEFPMSPVTSAHAGTYRCYGSLSSNPYLLTHPSDPLELVVS    351 - 420
GAAETLSPPQNKSDSKAGE                                                       421 - 439
//

Text Mined References (39)

PMID Year Title
26969150 2016 TLR8 regulation of LILRA3 in monocytes is abrogated in human immunodeficiency virus infection and correlates to CD4 counts and virus loads.
26871720 2016 Serum Leukocyte Immunoglobulin-Like Receptor A3 (LILRA3) Is Increased in Patients with Multiple Sclerosis and Is a Strong Independent Indicator of Disease Severity; 6.7kbp LILRA3 Gene Deletion Is Not Associated with Diseases Susceptibility.
26274821 2015 Influence of the LILRA3 Deletion on Multiple Sclerosis Risk: Original Data and Meta-Analysis.
24906639 2015 Impact of the leucocyte immunoglobulin-like receptor A3 (LILRA3) on susceptibility and subphenotypes of systemic lupus erythematosus and Sjögren's syndrome.
24899637 2014 Immunoglobulin-like transcripts 6 (ILT6) polymorphism influences the anti-Ro60/52 autoantibody status in South Indian SLE patients.
24757135 2014 Contribution of functional LILRA3, but not nonfunctional LILRA3, to sex bias in susceptibility and severity of anti-citrullinated protein antibody-positive rheumatoid arthritis.
24363809 2013 Association of the LILRA3 deletion with B-NHL and functional characterization of the immunostimulatory molecule.
24085305 2013 Glycosylation in a mammalian expression system is critical for the production of functionally active leukocyte immunoglobulin-like receptor A3 protein.
23615473 2013 LILRA3 is associated with benign prostatic hyperplasia risk in a Chinese Population.
23238213 2013 6.7-kbp deletion in LILRA3 (ILT6) gene is associated with later onset of the multiple sclerosis in a Polish population.
More...