Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.07
PubTator Score 5.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 1.78510339782382E-54
posterior fossa group A ependymoma 1511 1.41024715491678E-19
pilocytic astrocytoma 3086 3.36844565909191E-12
pituitary cancer 1972 6.72161173541003E-7
pediatric high grade glioma 2712 1.49796377053539E-5
medulloblastoma 1524 2.68576932763285E-5
Pick disease 1893 3.27103930219599E-5
glioblastoma 5572 3.69576828949352E-4
atypical teratoid / rhabdoid tumor 4369 8.64184354765146E-4
medulloblastoma, large-cell 6234 0.00169348334833532
astrocytic glioma 2241 0.00340617076955908
oligodendroglioma 2849 0.00696836679215505
Alzheimer's disease 644 0.0225665911418067

Synonym

Accession Q8N6C7 D6W630 Q17RJ9 Q8N6C6
Symbols Huh7
PGSF1
C19orf30
LINC00306
NCRNA00306
uc002mbe.2

Gene

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
26453926 These findings point to a new mechanism by which miR-7 exerts cytoprotective effects by regulating the Nrf2 pathway.

AA Sequence

MPGMRLVCRLAHGHFPRKGQRRRSLTVWKAETSRADCLGAPNIRTAPLGRSEKRTAICFSTGAQDSSQRA      1 - 70
PFRLQNPGQLLQLGMHSLHLHPELPTTDPAFFCKLHFIKGNDPYCLTISHVKSVLTFS                 71 - 128
//

Text Mined References (8)

PMID Year Title
26453926 2015 MicroRNA-7 activates Nrf2 pathway by targeting Keap1 expression.
24586183 2014 Identification of novel genetic Loci associated with thyroid peroxidase antibodies and clinical thyroid disease.
23643933 2013 Induction of the liver cancer-down-regulated long noncoding RNA uc002mbe.2 mediates trichostatin-induced apoptosis of liver cancer cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11854097 2002 Expression profile of active genes in the human pituitary gland.