Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.08
PubTator Score 5.29

Knowledge Summary

Patent

No data available

Synonym

Accession Q8N6C7 D6W630 Q17RJ9 Q8N6C6
Symbols Huh7
PGSF1
C19orf30
LINC00306
NCRNA00306
uc002mbe.2

Gene

Gene RIF (4)

AA Sequence

MPGMRLVCRLAHGHFPRKGQRRRSLTVWKAETSRADCLGAPNIRTAPLGRSEKRTAICFSTGAQDSSQRA      1 - 70
PFRLQNPGQLLQLGMHSLHLHPELPTTDPAFFCKLHFIKGNDPYCLTISHVKSVLTFS                 71 - 128
//

Text Mined References (11)

PMID Year Title