Property Summary

NCBI Gene PubMed Count 10
Grant Count 10
R01 Count 10
Funding $715,623.45
PubMed Score 14.74
PubTator Score 5.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.200 0.041
osteosarcoma -1.863 0.008
medulloblastoma, large-cell -1.100 0.001
non-small cell lung cancer -2.338 0.000
lung cancer -2.700 0.000
interstitial cystitis 1.200 0.002
lung adenocarcinoma -2.000 0.000
psoriasis -1.100 0.000
lung carcinoma -1.700 0.000
ductal carcinoma in situ -1.600 0.000
invasive ductal carcinoma -2.300 0.000
acute myeloid leukemia -4.200 0.047

Gene RIF (5)

PMID Text
26095808 Data indicate 3 variants in 3 novel genes myc target 1 protein (MYCT1), caspase recruitment domain family member 8 (CARD8) and zinc finger protein 543 (ZNF543), associated with familial IgA nephropathy (IgAN).
22672838 hypermethylation contributed to the transcriptional down-regulation of MYCT1 and could inhibit cancer cell differentiation in laryngeal squamous cell cancer.
21998677 MYCT1-TV, a novel MYCT1 transcript, is regulated by c-Myc and down-regulation of MYCT1-TV/MYCT1 could contribute to LSCC development and function
21799513 results suggest MYCT1 transcription can be activated downstream of RUNX1-ETO as well as MYC, contributing to key aspects of the leukaemic phenotypes these oncoproteins promote
14562369 MTLC was down-regulated in the majority of gastric cancer tissues and could promote apoptosis of GC cell lines, which suggests that MTLC may play an important role in the carcinogenesis of gastric carcinoma.

AA Sequence

MRTQVYEGLCKNYFSLAVLQRDRIKLLFFDILVFLSVFLLFLLFLVDIMANNTTSLGSPWPENFWEDLIM      1 - 70
SFTVSMAIGLVLGGFIWAVFICLSRRRRASAPISQWSSSRRSRSSYTHGLNRTGFYRHSGCERRSNLSLA     71 - 140
SLTFQRQASLEQANSFPRKSSFRASTFHPFLQCPPLPVETESQLVTLPSSNISPTISTSHSLSRPDYWSS    141 - 210
NSLRVGLSTPPPPAYESIIKAFPDS                                                 211 - 235
//

Text Mined References (14)

PMID Year Title
26095808 2015 Novel genes and variants associated with IgA nephropathy by co-segregating with the disease phenotypes in 10 IgAN families.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22672838 2012 Promoter hypermethylation-induced transcriptional down-regulation of the gene MYCT1 in laryngeal squamous cell carcinoma.
21998677 2011 MYCT1-TV, a novel MYCT1 transcript, is regulated by c-Myc and may participate in laryngeal carcinogenesis.
21799513 2012 RUNX1-ETO deregulates the proliferation and growth factor responsiveness of human hematopoietic progenitor cells downstream of the myeloid transcription factor, MYCT1.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
More...