Property Summary

NCBI Gene PubMed Count 15
PubMed Score 84.53
PubTator Score 17.51

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Lupus Erythematosus, Systemic 73
Disease Target Count P-value
ovarian cancer 8492 6.21002278700987E-8
pilocytic astrocytoma 3086 1.85779317112603E-6
primary pancreatic ductal adenocarcinoma 1271 0.0313204889610509
Disease Target Count Z-score Confidence
systemic lupus erythematosus 172 0.0 2.0
Disease Target Count Z-score Confidence
Cri-Du-Chat syndrome 16 3.472 1.7
Lupus erythematosus 80 3.333 1.7

Expression

  Differential Expression (3)

Disease log2 FC p
primary pancreatic ductal adenocarcinoma 1.220 0.031
pilocytic astrocytoma 1.400 0.000
ovarian cancer -1.700 0.000

Synonym

Accession Q8N697 A6H8Y9 B3KTK1 Q71M34 Q7Z5F8 Q8TAH0
Symbols PHT1
PTR4
FP12591

Gene

PANTHER Protein Class (1)

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA Inparanoid
Pig OMA EggNOG
Opossum OMA Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
S.cerevisiae OMA EggNOG

Gene RIF (9)

PMID Text
25034154 Mutations in SLC15A4,a peptide transporter in NFkB signaling pathway, have been implicated in Systemic Lupus Erythematosus development in susceptible individuals.
24091983 Report role of SLC15A4 genetic variants in confering risk of systemic lupus erythematosus in Chinese population.
22950754 LNCaP expresses high levels of PEPT2 and PHT1.PC-3 demonstrates strong expression of PEPT1 and PHT1.
21366347 PEPT1,PEPT2, PHT1, and PHT2 are expressed in human nasal epithelium.
20516000 Significant associations were found for the single nucleotide polymorphism rs10847697 of SLC15A4 with discoid rash in patients with systemic lupus erythematosus
20516000 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19838193 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18259684 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEGSGGGAGERAPLLGARRAAAAAAAAGAFAGRRAACGAVLLTELLERAAFYGITSNLVLFLNGAPFCWE      1 - 70
GAQASEALLLFMGLTYLGSPFGGWLADARLGRARAILLSLALYLLGMLAFPLLAAPATRAALCGSARLLN     71 - 140
CTAPGPDAAARCCSPATFAGLVLVGLGVATVKANITPFGADQVKDRGPEATRRFFNWFYWSINLGAILSL    141 - 210
GGIAYIQQNVSFVTGYAIPTVCVGLAFVVFLCGQSVFITKPPDGSAFTDMFKILTYSCCSQKRSGERQSN    211 - 280
GEGIGVFQQSSKQSLFDSCKMSHGGPFTEEKVEDVKALVKIVPVFLALIPYWTVYFQMQTTYVLQSLHLR    281 - 350
IPEISNITTTPHTLPAAWLTMFDAVLILLLIPLKDKLVDPILRRHGLLPSSLKRIAVGMFFVMCSAFAAG    351 - 420
ILESKRLNLVKEKTINQTIGNVVYHAADLSLWWQVPQYLLIGISEIFASIAGLEFAYSAAPKSMQSAIMG    421 - 490
LFFFFSGVGSFVGSGLLALVSIKAIGWMSSHTDFGNINGCYLNYYFFLLAAIQGATLLLFLIISVKYDHH    491 - 560
RDHQRSRANGVPTSRRA                                                         561 - 577
//

Text Mined References (19)

PMID Year Title
25034154 2014 Clinical perspectives on lupus genetics: advances and opportunities.
24091983 2014 Variants in TNFSF4, TNFAIP3, TNIP1, BLK, SLC15A4 and UBE2L3 interact to confer risk of systemic lupus erythematosus in Chinese population.
23362303 2013 Genome-wide association study identifies novel loci associated with concentrations of four plasma phospholipid fatty acids in the de novo lipogenesis pathway: results from the Cohorts for Heart and Aging Research in Genomic Epidemiology (CHARGE) consortium.
23273568 2013 Meta-analysis followed by replication identifies loci in or near CDKN1B, TET3, CD80, DRAM1, and ARID5B as associated with systemic lupus erythematosus in Asians.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22950754 2013 Expression profile and functional activity of peptide transporters in prostate cancer cells.
21366347 2011 Proton-coupled oligopeptide transporter (POT) family expression in human nasal epithelium and their drug transport potential.
20516000 2010 TNIP1, SLC15A4, ETS1, RasGRP3 and IKZF1 are associated with clinical features of systemic lupus erythematosus in a Chinese Han population.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19838193 2009 Genome-wide association study in a Chinese Han population identifies nine new susceptibility loci for systemic lupus erythematosus.
More...