Property Summary

NCBI Gene PubMed Count 17
PubMed Score 75.55
PubTator Score 17.51

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Lupus Erythematosus, Systemic 67 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 6.2e-08
Astrocytoma, Pilocytic 3081 5.6e-06
primary pancreatic ductal adenocarcinoma 1109 3.1e-02
Disease Target Count Z-score Confidence
Systemic lupus erythematosus 194 0.0 3.0
Disease Target Count Z-score Confidence
Cri-Du-Chat syndrome 16 3.442 1.7
Lupus erythematosus 57 3.439 1.7

Expression

  Differential Expression (3)

Disease log2 FC p
Astrocytoma, Pilocytic 1.100 5.6e-06
ovarian cancer -1.700 6.2e-08
primary pancreatic ductal adenocarcinoma 1.220 3.1e-02

 MGI Phenotype (1)

Gene RIF (10)

AA Sequence

MEGSGGGAGERAPLLGARRAAAAAAAAGAFAGRRAACGAVLLTELLERAAFYGITSNLVLFLNGAPFCWE      1 - 70
GAQASEALLLFMGLTYLGSPFGGWLADARLGRARAILLSLALYLLGMLAFPLLAAPATRAALCGSARLLN     71 - 140
CTAPGPDAAARCCSPATFAGLVLVGLGVATVKANITPFGADQVKDRGPEATRRFFNWFYWSINLGAILSL    141 - 210
GGIAYIQQNVSFVTGYAIPTVCVGLAFVVFLCGQSVFITKPPDGSAFTDMFKILTYSCCSQKRSGERQSN    211 - 280
GEGIGVFQQSSKQSLFDSCKMSHGGPFTEEKVEDVKALVKIVPVFLALIPYWTVYFQMQTTYVLQSLHLR    281 - 350
IPEISNITTTPHTLPAAWLTMFDAVLILLLIPLKDKLVDPILRRHGLLPSSLKRIAVGMFFVMCSAFAAG    351 - 420
ILESKRLNLVKEKTINQTIGNVVYHAADLSLWWQVPQYLLIGISEIFASIAGLEFAYSAAPKSMQSAIMG    421 - 490
LFFFFSGVGSFVGSGLLALVSIKAIGWMSSHTDFGNINGCYLNYYFFLLAAIQGATLLLFLIISVKYDHH    491 - 560
RDHQRSRANGVPTSRRA                                                         561 - 577
//

Text Mined References (21)

PMID Year Title