Property Summary

Ligand Count 3
NCBI Gene PubMed Count 40
PubMed Score 82.78
PubTator Score 58.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Hyperuricemia 49 3.037 1.5
Colonic Neoplasms 142 0.0 0.0
Disease Target Count P-value
lung carcinoma 2843 1.9e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Melanoma 711 0.0 0.5
Disease Target Count Z-score Confidence
Pendred Syndrome 22 3.671 1.8
Cancer 2499 3.061 1.5

Expression

  Differential Expression (1)

Disease log2 FC p
lung carcinoma -1.200 1.9e-04

Gene RIF (35)

AA Sequence

MDTPRGIGTFVVWDYVVFAGMLVISAAIGIYYAFAGGGQQTSKDFLMGGRRMTAVPVALSLTASFMSAVT      1 - 70
VLGTPSEVYRFGAIFSIFAFTYFFVVVISAEVFLPVFYKLGITSTYEYLELRFNKCVRLCGTVLFIVQTI     71 - 140
LYTGIVIYAPALALNQVTGFDLWGAVVATGVVCTFYCTLGGLKAVIWTDVFQVGIMVAGFASVIIQAVVM    141 - 210
QGGISTILNDAYDGGRLNFWNFNPNPLQRHTFWTIIIGGTFTWTSIYGVNQSQVQRYISCKSRFQAKLSL    211 - 280
YINLVGLWAILTCSVFCGLALYSRYHDCDPWTAKKVSAPDQLMPYLVLDILQDYPGLPGLFVACAYSGTL    281 - 350
STVSSSINALAAVTVEDLIKPYFRSLSERSLSWISQGMSVVYGALCIGMAALASLMGALLQAALSVFGMV    351 - 420
GGPLMGLFALGILVPFANSIGALVGLMAGFAISLWVGIGAQIYPPLPERTLPLHLDIQGCNSTYNETNLM    421 - 490
TTTEMPFTTSVFQIYNVQRTPLMDNWYSLSYLYFSTVGTLVTLLVGILVSLSTGGRKQNLDPRYILTKED    491 - 560
FLSNFDIFKKKKHVLSYKSHPVEDGGTDNPAFNHIELNSDQSGKSNGTRL                        561 - 610
//

Text Mined References (47)

PMID Year Title