Property Summary

NCBI Gene PubMed Count 37
Grant Count 38
R01 Count 22
Funding $3,590,471.16
PubMed Score 72.67
PubTator Score 58.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Expression

  Differential Expression (1)

Disease log2 FC p
lung carcinoma -1.200 0.000

Gene RIF (32)

PMID Text
26285906 Data suggest that SLC5A8, SLC5A5 (sodium-iodide symporter), and SLC26A4 (pendrin), the 3 known iodide transporters, are important in breast tissue metabolism in lactation and in breast neoplasms. [REVIEW]
25827678 Gene silencing of SLC5A8 by hypermethylation was associated with poor prognosis in cases of node-negative stage I and II lung adenocarcinoma.
23918800 Data indicate oncogenic HRAS (HRAS(G12V)) as a potent mediator of SLC5A8 silencing in human nontransformed normal mammary epithelial cell lines and in mouse mammary tumors through DNMT1.
23273563 These results suggest that DNA methylation in the SLC5A8 promoter region may suppress the expression of SLC5A8 in lung tumor.
23167260 SLC5A8 suppresses tumour progression through depletion of survivin without involving its transport function
22450368 SLC5A8 nuclear translocation and loss of expression are associated with poor outcome in pancreatic ductal adenocarcinoma.
21802122 SLC5A8 has a role in prostate cancer risk and aggressiveness
21687703 SLC5A8 is highly methylated in African American colon adenomas
20965718 Observational study of gene-disease association. (HuGE Navigator)
20671196 Efficacy of LP or their secreted soluble factors to stimulate SMCT1 expression and function and to counteract the inhibitory effects of TNF-alpha on butyrate absorption could have potential therapeutic value.
More...

AA Sequence

MDTPRGIGTFVVWDYVVFAGMLVISAAIGIYYAFAGGGQQTSKDFLMGGRRMTAVPVALSLTASFMSAVT      1 - 70
VLGTPSEVYRFGAIFSIFAFTYFFVVVISAEVFLPVFYKLGITSTYEYLELRFNKCVRLCGTVLFIVQTI     71 - 140
LYTGIVIYAPALALNQVTGFDLWGAVVATGVVCTFYCTLGGLKAVIWTDVFQVGIMVAGFASVIIQAVVM    141 - 210
QGGISTILNDAYDGGRLNFWNFNPNPLQRHTFWTIIIGGTFTWTSIYGVNQSQVQRYISCKSRFQAKLSL    211 - 280
YINLVGLWAILTCSVFCGLALYSRYHDCDPWTAKKVSAPDQLMPYLVLDILQDYPGLPGLFVACAYSGTL    281 - 350
STVSSSINALAAVTVEDLIKPYFRSLSERSLSWISQGMSVVYGALCIGMAALASLMGALLQAALSVFGMV    351 - 420
GGPLMGLFALGILVPFANSIGALVGLMAGFAISLWVGIGAQIYPPLPERTLPLHLDIQGCNSTYNETNLM    421 - 490
TTTEMPFTTSVFQIYNVQRTPLMDNWYSLSYLYFSTVGTLVTLLVGILVSLSTGGRKQNLDPRYILTKED    491 - 560
FLSNFDIFKKKKHVLSYKSHPVEDGGTDNPAFNHIELNSDQSGKSNGTRL                        561 - 610
//

Text Mined References (44)

PMID Year Title
26285906 2015 Iodide transport and breast cancer.
25827678 2015 Prognostic Significance of Aberrant Methylation of Solute Carrier Gene Family 5A8 in Lung Adenocarcinoma.
23918800 2013 Molecular mechanism of SLC5A8 inactivation in breast cancer.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23273563 2013 Gene silencing of SLC5A8 identified by genome-wide methylation profiling in lung cancer.
23167260 2013 The plasma membrane transporter SLC5A8 suppresses tumour progression through depletion of survivin without involving its transport function.
22450368 2012 SLC5A8 nuclear translocation and loss of expression are associated with poor outcome in pancreatic ductal adenocarcinoma.
21802122 2011 Protein expressions and genetic variations of SLC5A8 in prostate cancer risk and aggressiveness.
21687703 2011 SLC5A8 gene, a transporter of butyrate: a gut flora metabolite, is frequently methylated in African American colon adenomas.
20965718 2011 Genetic variability of the fatty acid synthase pathway is not associated with prostate cancer risk in the European Prospective Investigation on Cancer (EPIC).
More...