Property Summary

NCBI Gene PubMed Count 12
Grant Count 33
R01 Count 11
Funding $15,387,117.79
PubMed Score 178.56
PubTator Score 30.69

Knowledge Summary

Patent

No data available

Gene RIF (5)

PMID Text
25316452 ESX1 mRNA level decreases as the severity of spermatogenic defects increase in non-obstructive azoospermic men.
20356899 ESX1 emerges as a potentially reliable molecular marker of residual spermatogenesis in azoospermic men
16613891 In FGR-affected placentae, ESX1L levels were lower than in gestation-matched controls, indicating a potential role for the ESX1L gene within the growth control mechanism of the fetus, through its effect on placental function.
15601583 ESX1L is expressed during all stages of placental development and is localized to sparse areas of trophoblast in terminal villi in association with cytotrophoblastic cells
15235584 proteolytic processing of ESXR1 plays a role in concerted regulation of the cell cycle and transcription in human cells

AA Sequence

MESLRGYTHSDIGYRSLAVGEDIEEVNDEKLTVTSLMARGGEDEENTRSKPEYGTEAENNVGTEGSVPSD      1 - 70
DQDREGGGGHEPEQQQEEPPLTKPEQQQEEPPLLELKQEQEEPPQTTVEGPQPAEGPQTAEGPQPPERKR     71 - 140
RRRTAFTQFQLQELENFFDESQYPDVVARERLAARLNLTEDRVQVWFQNRRAKWKRNQRVLMLRNTATAD    141 - 210
LAHPLDMFLGGAYYAAPALDPALCVHLVPQLPRPPVLPVPPMPPRPPMVPMPPRPPIAPMPPMAPVPPGS    211 - 280
RMAPVPPGPRMAPVPPWPPMAPVPPWPPMAPVPTGPPMAPVPPGPPMARVPPGPPMARVPPGPPMAPLPP    281 - 350
GPPMAPLPPGPPMAPLPPGPPMAPLPPRSHVPHTGLAPVHITWAPVINSYYACPFF                  351 - 406
//

Text Mined References (13)

PMID Year Title
25316452 2014 ESX1 mRNA expression in seminal fluid is an indicator of residual spermatogenesis in non-obstructive azoospermic men.
20356899 2010 ESX1 gene expression as a robust marker of residual spermatogenesis in azoospermic men.
17588961 2007 Rapid evolution of primate ESX1, an X-linked placenta- and testis-expressed homeobox gene.
17242862 2007 Mapping and identification of candidate loci responsible for Peromyscus hybrid overgrowth.
16613891 2006 Homeobox gene ESX1L expression is decreased in human pre-term idiopathic fetal growth restriction.
15897875 2005 Paired-like homeoprotein ESXR1 acts as a sequence-specific transcriptional repressor of the human K-ras gene.
15772651 2005 The DNA sequence of the human X chromosome.
15601583 Molecular and morphologic analyses of expression of ESX1L in different stages of human placental development.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15235584 2004 Paired-like homeodomain protein ESXR1 possesses a cleavable C-terminal region that inhibits cyclin degradation.
More...