Property Summary

NCBI Gene PubMed Count 13
PubMed Score 1.33
PubTator Score 1.75

Knowledge Summary

Patent

No data available

Gene RIF (4)

PMID Text
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
19423540 Observational study of gene-disease association. (HuGE Navigator)
15772680 A couple of isoforms encoded by this gene are thought to display antimicrobial activity.

AA Sequence

MKLLYLFLAILLAIEEPVISGKRHILRCMGNSGICRASCKKNEQPYLYCRNCQSCCLQSYMRISISGKEE      1 - 70
NTDWSYEKQWPRLP                                                             71 - 84
//

Text Mined References (13)

PMID Year Title
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
16710608 2006 Human beta-defensins.
15772680 2005 Identification, characterization, and evolution of a primate beta-defensin gene cluster.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12128228 2002 Testis-specific expression of a novel mouse defensin-like gene, Tdl.
11854508 2002 Discovery of five conserved beta -defensin gene clusters using a computational search strategy.
More...