Property Summary

NCBI Gene PubMed Count 13
PubMed Score 1.33
PubTator Score 1.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Gene RIF (4)

AA Sequence

MKLLYLFLAILLAIEEPVISGKRHILRCMGNSGICRASCKKNEQPYLYCRNCQSCCLQSYMRISISGKEE      1 - 70
NTDWSYEKQWPRLP                                                             71 - 84
//

Text Mined References (13)

PMID Year Title