Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.65
PubTator Score 1.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Otitis media 32 3.362 1.7

Gene RIF (1)

PMID Text
15772680 The protein encoded by this gene is thought to display antimicrobial activity.

AA Sequence

MKLLLLTLTVLLLLSQLTPGGTQRCWNLYGKCRYRCSKKERVYVYCINNKMCCVKPKYQPKERWWPF         1 - 67
//

Text Mined References (6)

PMID Year Title
15772680 2005 Identification, characterization, and evolution of a primate beta-defensin gene cluster.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11854508 2002 Discovery of five conserved beta -defensin gene clusters using a computational search strategy.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.