Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.82
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Infertility 163 3.296 1.6

Gene RIF (1)

PMID Text
12620395 The protein encoded by this gene is thought to display antimicrobial activity.

AA Sequence

MNILMLTFIICGLLTRVTKGSFEPQKCWKNNVGHCRRRCLDTERYILLCRNKLSCCISIISHEYTRRPAF      1 - 70
PVIHLEDITLDYSDVDSFTGSPVSMLNDLITFDTTKFGETMTPETNTPETTMPPSEATTPETTMPPSETA     71 - 140
TSETMPPPSQTALTHN                                                          141 - 156
//

Text Mined References (5)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12620395 2003 Distribution of new human beta-defensin genes clustered on chromosome 20 in functionally different segments of epididymis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11854508 2002 Discovery of five conserved beta -defensin gene clusters using a computational search strategy.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.