Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.86
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Gene RIF (1)

AA Sequence

MNILMLTFIICGLLTRVTKGSFEPQKCWKNNVGHCRRRCLDTERYILLCRNKLSCCISIISHEYTRRPAF      1 - 70
PVIHLEDITLDYSDVDSFTGSPVSMLNDLITFDTTKFGETMTPETNTPETTMPPSEATTPETTMPPSETA     71 - 140
TSETMPPPSQTALTHN                                                          141 - 156
//

Text Mined References (5)

PMID Year Title