Property Summary

NCBI Gene PubMed Count 18
PubMed Score 0.67
PubTator Score 1.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Expression

  Differential Expression (4)

Disease log2 FC p
astrocytic glioma 1.300 0.006
ependymoma 1.500 0.002
oligodendroglioma 1.400 0.002
psoriasis -1.800 0.000

Synonym

Accession Q8N684 B3KU04 C9K0Q4 Q7Z3H9 Q9H025 Q9H9V1
Symbols CFIm59

Gene

PDB

3N9U  

Gene RIF (6)

PMID Text
23125841 Tandem affinity purification and mass spectrometry analysis identify 59kDa cleavage and polyadenylation specific factor 7 (CPSF7), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify 59kDa cleavage and polyadenylation specific factor 7 (CPSF7), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify 59kDa cleavage and polyadenylation specific factor 7 (CPSF7), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify 59kDa cleavage and polyadenylation specific factor 7 (CPSF7), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22174317 Tandem affinity purification and mass spectrometry analysis identify 59kDa cleavage and polyadenylation specific factor 7 (CPSF7), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
20695905 Data provide evidence that CFIm exists as a heterotetramer of 25-kD, 59-kD and 68-kD subunits of CFIm: CFIm25, CFIm59 and CFIm68.

AA Sequence

MSEGVDLIDIYADEEFNQDPEFNNTDQIDLYDDVLTATSQPSDDRSSSTEPPPPVRQEPSPKPNNKTPAI      1 - 70
LYTYSGLRNRRAAVYVGSFSWWTTDQQLIQVIRSIGVYDVVELKFAENRANGQSKGYAEVVVASENSVHK     71 - 140
LLELLPGKVLNGEKVDVRPATRQNLSQFEAQARKRECVRVPRGGIPPRAHSRDSSDSADGRATPSENLVP    141 - 210
SSARVDKPPSVLPYFNRPPSALPLMGLPPPPIPPPPPLSSSFGVPPPPPGIHYQHLMPPPPRLPPHLAVP    211 - 280
PPGAIPPALHLNPAFFPPPNATVGPPPDTYMKASAPYNHHGSRDSGPPPSTVSEAEFEDIMKRNRAISSS    281 - 350
AISKAVSGASAGDYSDAIETLLTAIAVIKQSRVANDERCRVLISSLKDCLHGIEAKSYSVGASGSSSRKR    351 - 420
HRSRERSPSRSRESSRRHRDLLHNEDRHDDYFQERNREHERHRDRERDRHH                       421 - 471
//

Text Mined References (26)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23187700 2012 Cleavage factor Im is a key regulator of 3' UTR length.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
20695905 2010 Evidence that cleavage factor Im is a heterotetrameric protein complex controlling alternative polyadenylation.
19946888 2010 Defining the membrane proteome of NK cells.
More...