Property Summary

NCBI Gene PubMed Count 18
PubMed Score 0.77
PubTator Score 1.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 9.3e-05
oligodendroglioma 2850 1.9e-03
ependymoma 4679 2.1e-03
astrocytic glioma 2597 5.8e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (4)

Disease log2 FC p
astrocytic glioma 1.300 5.8e-03
ependymoma 1.500 2.1e-03
oligodendroglioma 1.400 1.9e-03
psoriasis -1.800 9.3e-05

Gene RIF (3)

AA Sequence

MSEGVDLIDIYADEEFNQDPEFNNTDQIDLYDDVLTATSQPSDDRSSSTEPPPPVRQEPSPKPNNKTPAI      1 - 70
LYTYSGLRNRRAAVYVGSFSWWTTDQQLIQVIRSIGVYDVVELKFAENRANGQSKGYAEVVVASENSVHK     71 - 140
LLELLPGKVLNGEKVDVRPATRQNLSQFEAQARKRECVRVPRGGIPPRAHSRDSSDSADGRATPSENLVP    141 - 210
SSARVDKPPSVLPYFNRPPSALPLMGLPPPPIPPPPPLSSSFGVPPPPPGIHYQHLMPPPPRLPPHLAVP    211 - 280
PPGAIPPALHLNPAFFPPPNATVGPPPDTYMKASAPYNHHGSRDSGPPPSTVSEAEFEDIMKRNRAISSS    281 - 350
AISKAVSGASAGDYSDAIETLLTAIAVIKQSRVANDERCRVLISSLKDCLHGIEAKSYSVGASGSSSRKR    351 - 420
HRSRERSPSRSRESSRRHRDLLHNEDRHDDYFQERNREHERHRDRERDRHH                       421 - 471
//

Text Mined References (27)

PMID Year Title