Property Summary

NCBI Gene PubMed Count 25
PubMed Score 53.58
PubTator Score 55.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
active Crohn's disease 2.566 5.0e-04
active ulcerative colitis 2.166 1.5e-03
adult high grade glioma 1.300 2.3e-04
aldosterone-producing adenoma -1.309 1.2e-02
astrocytoma 1.400 3.9e-02
Astrocytoma, Pilocytic 1.900 1.9e-11
atypical teratoid / rhabdoid tumor 1.400 1.1e-04
breast carcinoma 1.300 7.6e-03
cystic fibrosis 2.205 3.2e-06
ependymoma 1.300 2.6e-06
esophageal adenocarcinoma 1.300 1.8e-02
glioblastoma 1.500 3.2e-07
lung adenocarcinoma -1.200 4.4e-07
lung cancer -3.100 1.2e-03
lung carcinoma -4.100 3.8e-31
malignant mesothelioma -2.500 5.9e-08
non-small cell lung cancer -1.878 1.7e-14
osteosarcoma -1.481 3.5e-03
ovarian cancer -2.200 4.6e-07
primitive neuroectodermal tumor 1.300 8.1e-03
subependymal giant cell astrocytoma 2.854 4.7e-03
tuberculosis -1.500 2.7e-06

Gene RIF (17)

AA Sequence

MLCFLRGMAFVPFLLVTWSSAAFIISYVVAVLSGHVNPFLPYISDTGTTPPESGIFGFMINFSAFLGAAT      1 - 70
MYTRYKIVQKQNQTCYFSTPVFNLVSLVLGLVGCFGMGIVANFQELAVPVVHDGGALLAFVCGVVYTLLQ     71 - 140
SIISYKSCPQWNSLSTCHIRMVISAVSCAAVIPMIVCASLISITKLEWNPREKDYVYHVVSAICEWTVAF    141 - 210
GFIFYFLTFIQDFQSVTLRISTEINGDI                                              211 - 238
//

Text Mined References (28)

PMID Year Title