Property Summary

NCBI Gene PubMed Count 25
Grant Count 9
R01 Count 1
Funding $682,517.63
PubMed Score 51.54
PubTator Score 55.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Gene RIF (17)

PMID Text
25633293 DRAM1 regulates apoptosis by inhibiting BAX degradation.
24922577 DRAM1 mediates autophagic defense against a broader range of intracellular pathogens, since DRAM1 expression was also induced by the common bacterial endotoxin lipopolysaccharide.
24556693 Suggest that promoting DRAM-mediated autophagy together with PI3K/AKT inhibition might be more effective for autophagy-based therapy in hepatoma.
24133622 DRAM is an important gene for the enhancement of p53-dependent apoptosis.
23832602 DRAM gene expression is down regulated by oxidative stress through the mediation of reactive oxygen species
23696801 DRAM1 affects autophagy through lysosomal acidification, fusion of lysosomes with autophagosomes and clearance of autophagosomes.
23658518 DRAM triggers lysosomal membrane permeabilization and cell death in CD4(+) T cells infected with HIV.
23337876 Overexpression of miR-199a-5p inhibits DRAM1 and Beclin1 expression.
22981223 p73-regulated DRAM-1 is functionally involved in neutrophil differentiation of acute promyelocytic leukemia cells.
22525272 these findings shed new light on the role of autophagy in GBM and reveal a novel function of the autophagy regulators DRAM1 and p62 in control of migration/invasion in cancer stem cells.
More...

AA Sequence

MLCFLRGMAFVPFLLVTWSSAAFIISYVVAVLSGHVNPFLPYISDTGTTPPESGIFGFMINFSAFLGAAT      1 - 70
MYTRYKIVQKQNQTCYFSTPVFNLVSLVLGLVGCFGMGIVANFQELAVPVVHDGGALLAFVCGVVYTLLQ     71 - 140
SIISYKSCPQWNSLSTCHIRMVISAVSCAAVIPMIVCASLISITKLEWNPREKDYVYHVVSAICEWTVAF    141 - 210
GFIFYFLTFIQDFQSVTLRISTEINGDI                                              211 - 238
//

Text Mined References (28)

PMID Year Title
25633293 2015 DRAM1 regulates apoptosis through increasing protein levels and lysosomal localization of BAX.
25416956 2014 A proteome-scale map of the human interactome network.
24922577 2014 The DNA damage-regulated autophagy modulator DRAM1 links mycobacterial recognition via TLR-MYD88 to autophagic defense [corrected].
24556693 2014 Phosphorylated AKT inhibits the apoptosis induced by DRAM-mediated mitophagy in hepatocellular carcinoma by preventing the translocation of DRAM to mitochondria.
24133622 2013 Overexpression of DRAM enhances p53-dependent apoptosis.
23832602 2013 Reactive oxygen species-dependent down-regulation of tumor suppressor genes PTEN, USP28, DRAM, TIGAR, and CYLD under oxidative stress.
23696801 2013 DRAM1 regulates autophagy flux through lysosomes.
23658518 2013 DRAM triggers lysosomal membrane permeabilization and cell death in CD4(+) T cells infected with HIV.
23337876 2013 Differential roles of miR-199a-5p in radiation-induced autophagy in breast cancer cells.
23273568 2013 Meta-analysis followed by replication identifies loci in or near CDKN1B, TET3, CD80, DRAM1, and ARID5B as associated with systemic lupus erythematosus in Asians.
More...