Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.89
PubTator Score 3.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
ovarian cancer 8,484

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.200 0.001

Gene RIF (4)

PMID Text
25609694 ZBTB2 may increase cell proliferation by reprogramming glucose metabolic pathways to favor glycolysis by upregulating PDK4 expression via repression of RelA/p65 expression
24607898 ZBTB2 being considered as a multifunctional cell proliferation activator, notably through p21 repression, this work points out new epigenetic processes potentially involved in carcinogenesis.
19380588 ZBTB2 is a potential proto-oncogenic master control gene of the p53 pathway and, in particular, is a potent transcription repressor of the cell cycle arrest gene p21 by inhibiting p53 and Sp1
18187620 Knockdown of zinc finger and BTB domain containing 2 (ZBTB2) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MDLANHGLILLQQLNAQREFGFLCDCTVAIGDVYFKAHKSVLASFSNYFKMLFVHQTSECVRLKPTDIQP      1 - 70
DIFSYLLHLMYTGKMAPQLIDPVRLEQGIKFLHAYPLIQEASLASQGAFSHPDQVFPLASSLYGIQIADH     71 - 140
QLRQATKIASAPEKLGRDPRPQTSRISQEQVPEASQLSQLTSNLAQVNRTNMTPSDPLQTSLSPELVSTP    141 - 210
VPPPPPGEETNLEASSSDEQPASLTIAHVKPSIMKRNGSFPKYYACHLCGRRFTLRSSLREHLQIHTGVP    211 - 280
FTSSQQGESRVPLTLCSNAADLGKDAMEVPEAGMISDSELQHISDSPIIDGQQQSETPPPSDIADIDNLE    281 - 350
QADQEREVKRRKYECTICGRKFIQKSHWREHMYIHTGKPFKCSTCDKSFCRANQAARHVCLNQSIDTYTM    351 - 420
VDKQTLELCTFEEGSQMDNMLVQTNKPYKCNLCDKTFSTPNEVVKHSCQNQNSDVFALDEGRSILLGSGD    421 - 490
SEVTEPDHPVLASIKKEQETVLLD                                                  491 - 514
//

Text Mined References (15)

PMID Year Title
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25609694 2015 ZBTB2 increases PDK4 expression by transcriptional repression of RelA/p65.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24607898 2014 DNA binding of the p21 repressor ZBTB2 is inhibited by cytosine hydroxymethylation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21540461 2011 A genome-wide association study identifies novel loci associated with susceptibility to chronic myeloid leukemia.
19380588 2009 ZBTB2, a novel master regulator of the p53 pathway.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
16051665 2005 Proteomic analysis of steady-state nuclear hormone receptor coactivator complexes.
More...