Property Summary

NCBI Gene PubMed Count 63
PubMed Score 69.99
PubTator Score 53.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer -1.400 1.4e-09

 GWAS Trait (1)

Gene RIF (46)

AA Sequence

MAAGELEGGKPLSGLLNALAQDTFHGYPGITEELLRSQLYPEVPPEEFRPFLAKMRGILKSIASADMDFN      1 - 70
QLEAFLTAQTKKQGGITSDQAAVISKFWKSHKTKIRESLMNQSRWNSGLRGLSWRVDGKSQSRHSAQIHT     71 - 140
PVAIIELELGKYGQESEFLCLEFDEVKVNQILKTLSEVEESISTLISQPN                        141 - 190
//

Text Mined References (70)

PMID Year Title