Property Summary

NCBI Gene PubMed Count 59
Grant Count 34
R01 Count 28
Funding $3,142,872.34
PubMed Score 64.68
PubTator Score 53.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.900 0.000

Gene RIF (42)

PMID Text
25520503 IkappaB-alpha protein was stabilized by COMMD1, which attenuated NF-kappaB signaling during Toll-like receptor ligand and tumor necrosis factor alpha treatment and enhanced HIV-1 latency in latently HIV-1-infected cells.
25355947 COMMD1 is directly linked to early endosomes through its interaction with a protein complex containing CCDC22, CCDC93, and C16orf62.
25074812 COMMD1 is acetylated by p300 and that acetylation protects COMMD1 from XIAP-mediated proteosomal degradation
24691167 COMMD1 is identified as a novel regulator of misfolded protein aggregation.
24625556 COMMD1 expression is associated with poor prognosis in diffuse large B-cell lymphoma
23892095 These data demonstrate the anti-inflammatory properties of COMMD1 in bronchial epithelial cells and open new therapeutic avenues in cystic fibrosis.
23677795 The role of COMMD1 in copper metabolism and it structure and function are discussed.
23515529 The results indicate a role for COMMD1 in the regulation of NKCC1 membrane expression and ubiquitination.
23364987 Placental COMMD1 expression is increased in women with severe preeclampsia compared to that found in women with normal pregnancies.
22677543 No major role can be attributed to Atox1 and COMMD in the pathophysiology or clinical variation of Wilson disease.
More...

AA Sequence

MAAGELEGGKPLSGLLNALAQDTFHGYPGITEELLRSQLYPEVPPEEFRPFLAKMRGILKSIASADMDFN      1 - 70
QLEAFLTAQTKKQGGITSDQAAVISKFWKSHKTKIRESLMNQSRWNSGLRGLSWRVDGKSQSRHSAQIHT     71 - 140
PVAIIELELGKYGQESEFLCLEFDEVKVNQILKTLSEVEESISTLISQPN                        141 - 190
//

Text Mined References (66)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25520503 2015 COMMD1/Murr1 reinforces HIV-1 latent infection through I?B-? stabilization.
25416956 2014 A proteome-scale map of the human interactome network.
25355947 2015 COMMD1 is linked to the WASH complex and regulates endosomal trafficking of the copper transporter ATP7A.
25074812 2014 p300-mediated acetylation of COMMD1 regulates its stability, and the ubiquitylation and nucleolar translocation of the RelA NF-?B subunit.
24691167 2014 The Copper Metabolism MURR1 domain protein 1 (COMMD1) modulates the aggregation of misfolded protein species in a client-specific manner.
24625556 2014 Deregulation of COMMD1 is associated with poor prognosis in diffuse large B-cell lymphoma.
23892095 2013 COMMD1 modulates noxious inflammation in cystic fibrosis.
23677795 2013 COMMD1 and ion transport proteins: what is the COMMection? Focus on "COMMD1 interacts with the COOH terminus of NKCC1 in Calu-3 airway epithelial cells to modulate NKCC1 ubiquitination".
More...