Property Summary

NCBI Gene PubMed Count 5
PubMed Score 4.60
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

AA Sequence

MDAGKAGQTLKTHCSAQRPDVCRWLSPFILSCCVYFCLWIPEDQLSWFAALVKCLPVLCLAGFLWVMSPS      1 - 70
GGYTQLLQGALVCSAVGDACLIWPAAFVPGMAAFATAHLLYVWAFGFSPLQPGLLLLIILAPGPYLSLVL     71 - 140
QHLEPDMVLPVAAYGLILMAMLWRGLAQGGSAGWGALLFTLSDGVLAWDTFAQPLPHAHLVIMTTYYAAQ    141 - 210
LLITLSALRSPVPKTD                                                          211 - 226
//

Text Mined References (6)

PMID Year Title