Property Summary

NCBI Gene PubMed Count 7
PubMed Score 5.46
PubTator Score 0.33

Knowledge Summary


No data available


  Disease Sources (1)


Accession Q8N660 A8MPT6 Q3BBV9 Q5SXJ2 Q8IX77
Symbols AG3


AA Sequence

VFYSFEEEHISFALYVDNRFFTLTVTSLHLVFQMGVIFPQ                                  631 - 670

Text Mined References (8)

PMID Year Title
22973535 2012 Evolutionary history and genome organization of DUF1220 protein domains.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16079250 2005 A novel gene family NBPF: intricate structure generated by gene duplications during primate evolution.
15489335 2004 Human ORFeome version 1.1: a platform for reverse proteomics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.