Property Summary

NCBI Gene PubMed Count 5
PubMed Score 4.81
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 8.6e-03
Disease Target Count Z-score Confidence
Infertility 188 3.415 1.7

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.200 8.6e-03

Gene RIF (3)

AA Sequence

MANSFAARIFTTLSDLQTNMANLKVIGIVIGKTDVKGFPDRKNIGSERYTFSFTIRDSPAHFVNAASWGN      1 - 70
EDYIKSLSDSFRVGDCVIIENPLIQRKEIEREEKFSPATPSNCKLLLSENHSTVKVCSSYEVDTKLLSLI     71 - 140
HLPVKESHDYYSLGDIVANGHSLNGRIINVLAAVKSVGEPKYFTTSDRRKGQRCEVRLYDETESSFAMTC    141 - 210
WDNESILLAQSWMPRETVIFASDVRINFDKFRNCMTATVISKTIITTNPDIPEANILLNFIRENKETNVL    211 - 280
DDEIDSYFKESINLSTIVDVYTVEQLKGKALKNEGKADPSYGILYAYISTLNIDDETTKVVRNRCSSCGY    281 - 350
IVNEASNMCTTCNKNSLDFKSVFLSFHVLIDLTDHTGTLHSCSLTGSVAEETLGCTFVLSHRARSGLKIS    351 - 420
VLSCKLADPTEASRNLSGQKHV                                                    421 - 442
//

Text Mined References (8)

PMID Year Title