Property Summary

NCBI Gene PubMed Count 5
Grant Count 3
R01 Count 2
Funding $248,000
PubMed Score 4.17
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.200 0.009

Synonym

Accession Q8N635 B1AK39 C9J0S1 Q96RY0
Symbols gs129
C16orf73

Gene

Gene RIF (3)

PMID Text
24240703 MEIOB interacts with RPA and SPATA22.
24068956 we propose that RPA and this new single-strand DNA binding protein MEIOB, are essential to ensure the proper stabilization of recombinases which is required for successful homology search and meiotic recombination.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MANSFAARIFTTLSDLQTNMANLKVIGIVIGKTDVKGFPDRKNIGSERYTFSFTIRDSPAHFVNAASWGN      1 - 70
EDYIKSLSDSFRVGDCVIIENPLIQRKEIEREEKFSPATPSNCKLLLSENHSTVKVCSSYEVDTKLLSLI     71 - 140
HLPVKESHDYYSLGDIVANGHSLNGRIINVLAAVKSVGEPKYFTTSDRRKGQRCEVRLYDETESSFAMTC    141 - 210
WDNESILLAQSWMPRETVIFASDVRINFDKFRNCMTATVISKTIITTNPDIPEANILLNFIRENKETNVL    211 - 280
DDEIDSYFKESINLSTIVDVYTVEQLKGKALKNEGKADPSYGILYAYISTLNIDDETTKVVRNRCSSCGY    281 - 350
IVNEASNMCTTCNKNSLDFKSVFLSFHVLIDLTDHTGTLHSCSLTGSVAEETLGCTFVLSHRARSGLKIS    351 - 420
VLSCKLADPTEASRNLSGQKHV                                                    421 - 442
//

Text Mined References (7)

PMID Year Title
24240703 2013 MEIOB exhibits single-stranded DNA-binding and exonuclease activities and is essential for meiotic recombination.
24068956 2013 MEIOB targets single-strand DNA and is necessary for meiotic recombination.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11157797 2001 Sequence, structure and pathology of the fully annotated terminal 2 Mb of the short arm of human chromosome 16.