Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00
PubTator Score 0.17

Knowledge Summary

Patent (140)

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9

Expression

AA Sequence

MMEIANVSSPEVFVLLGFSTRPSLETVLFIVVLSFYMVSILGNGIIILVSHTDVHLHTPMYFFLANLPFL      1 - 70
DMSFTTSIVPQLLANLWGPQKTISYGGCVVQFYISHWLGATECVLLATMSYDRYAAICRPLHYTVIMHPQ     71 - 140
LCLGLALASWLGGLTTSMVGSTLTMLLPLCGNNCIDHFFCEMPLIMQLACVDTSLNEMEMYLASFVFVVL    141 - 210
PLGLILVSYGHIARAVLKIRSAEGRRKAFNTCSSHVAVVSLFYGSIIFMYLQPAKSTSHEQGKFIALFYT    211 - 280
VVTPALNPLIYTLRNTEVKSALRHMVLENCCGSAGKLAQI                                  281 - 320
//

Text Mined References (6)

PMID Year Title