Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00
PubTator Score 0.17

Knowledge Summary

Patent (140)

AA Sequence

MMEIANVSSPEVFVLLGFSTRPSLETVLFIVVLSFYMVSILGNGIIILVSHTDVHLHTPMYFFLANLPFL      1 - 70
DMSFTTSIVPQLLANLWGPQKTISYGGCVVQFYISHWLGATECVLLATMSYDRYAAICRPLHYTVIMHPQ     71 - 140
LCLGLALASWLGGLTTSMVGSTLTMLLPLCGNNCIDHFFCEMPLIMQLACVDTSLNEMEMYLASFVFVVL    141 - 210
PLGLILVSYGHIARAVLKIRSAEGRRKAFNTCSSHVAVVSLFYGSIIFMYLQPAKSTSHEQGKFIALFYT    211 - 280
VVTPALNPLIYTLRNTEVKSALRHMVLENCCGSAGKLAQI                                  281 - 320
//

Text Mined References (6)

PMID Year Title
19684603 2009 Germline genomic variants associated with childhood acute lymphoblastic leukemia.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983052 2004 The human olfactory receptor gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.