Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.20
PubTator Score 0.17

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
cutaneous lupus erythematosus 1.500 3.8e-02
facioscapulohumeral dystrophy 2.100 1.4e-02
interstitial cystitis 2.100 7.3e-03
malignant mesothelioma -1.900 1.4e-07
non-small cell lung carcinoma 1.200 3.0e-15
osteosarcoma -2.402 4.2e-08

AA Sequence

MTKTALLKLFVAIVITFILILPEYFKTPKERTLELSCLEVCLQSNFTYSLSSLNFSFVTFLQPVRETQII      1 - 70
MRIFLNPSNFRNFTRTCQDITGEFKMCSSCLVCESKGNMDFISQEQTSKVLIRRGSMEVKANDFHSPCQH     71 - 140
FNFSVAPLVDHLEEYNTTCHLKNHTGRSTIMEDEPSKEKSINYTCRIMEYPNDCIHISLHLEMDIKNITC    141 - 210
SMKITWYILVLLVFIFLIILTIRKILEGQRRVQKWQSHRDKPTSVLLRGSDSEKLRALNVQVLSAETTQR    211 - 280
LPLDQVQEVLPPIPEL                                                          281 - 296
//

Text Mined References (3)

PMID Year Title