Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.17
PubTator Score 0.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung carcinoma 413 3.03111505163792E-15
osteosarcoma 7933 1.39900128740564E-11
malignant mesothelioma 3163 1.42924840494269E-7
interstitial cystitis 2299 0.00730953178960065
facioscapulohumeral dystrophy 286 0.0143005327356882
cutaneous lupus erythematosus 1056 0.037874125629603

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma -1.900 0.000
cutaneous lupus erythematosus 1.500 0.038
osteosarcoma -4.533 0.000
interstitial cystitis 2.100 0.007
non-small cell lung carcinoma 1.200 0.000
facioscapulohumeral dystrophy 2.100 0.014

Synonym

Accession Q8N614 Q9H5N9
Symbols

Gene

  Ortholog (9)

AA Sequence

MTKTALLKLFVAIVITFILILPEYFKTPKERTLELSCLEVCLQSNFTYSLSSLNFSFVTFLQPVRETQII      1 - 70
MRIFLNPSNFRNFTRTCQDITGEFKMCSSCLVCESKGNMDFISQEQTSKVLIRRGSMEVKANDFHSPCQH     71 - 140
FNFSVAPLVDHLEEYNTTCHLKNHTGRSTIMEDEPSKEKSINYTCRIMEYPNDCIHISLHLEMDIKNITC    141 - 210
SMKITWYILVLLVFIFLIILTIRKILEGQRRVQKWQSHRDKPTSVLLRGSDSEKLRALNVQVLSAETTQR    211 - 280
LPLDQVQEVLPPIPEL                                                          281 - 296
//

Text Mined References (3)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.