Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (2)

Disease log2 FC p
intraductal papillary-mucinous carcinoma... -1.100 0.008
pilocytic astrocytoma 1.200 0.000

Synonym

Accession Q8N609 Q8N2L7
Symbols

Gene

Gene RIF (1)

PMID Text
20332099 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGLRKKSTKNPPVLSQEFILQNHADIVSCVGMFFLLGLVFEGTAEASIVFLTLQHSVAVPAAEEQATGSK      1 - 70
SLYYYGVKDLATVFFYMLVAIIIHATIQEYVLDKINKRMQFTKAKQNKFNESGQFSVFYFFSCIWGTFIL     71 - 140
ISENCLSDPTLIWKARPHSMMTFQMKFFYISQLAYWFHAFPELYFQKTKKQDIPRQLVYIGLHLFHITGA    141 - 210
YLLYLNHLGLLLLVLHYFVELLSHMCGLFYFSDEKYQKGISLWAIVFILGRLVTLIVSVLTVGFHLAGSQ    211 - 280
NRNPDALTGNVNVLAAKIAVLSSSCTIQAYVTWNLITLWLQRWVEDSNIQASCMKKKRSRSSKKRTENGV    281 - 350
GVETSNRVDCPPKRKEKSS                                                       351 - 369
//

Text Mined References (9)

PMID Year Title
23897914 2013 A genome-wide association study (GWAS) for bronchopulmonary dysplasia.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
20332099 2010 A systematic gene-based screen of chr4q22-q32 identifies association of a novel susceptibility gene, DKK2, with the quantitative trait of alcohol dependence symptom counts.
19553259 2009 Common body mass index-associated variants confer risk of extreme obesity.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14749390 2004 TRAM2 protein interacts with endoplasmic reticulum Ca2+ pump Serca2b and is necessary for collagen type I synthesis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.