Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Alzheimer's disease 658 0.0 0.8
Disease Target Count Z-score Confidence
Alcohol abuse 50 3.15 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
Astrocytoma, Pilocytic 1.200 9.9e-05
intraductal papillary-mucinous carcinoma... -1.100 8.0e-03

Gene RIF (1)

AA Sequence

MGLRKKSTKNPPVLSQEFILQNHADIVSCVGMFFLLGLVFEGTAEASIVFLTLQHSVAVPAAEEQATGSK      1 - 70
SLYYYGVKDLATVFFYMLVAIIIHATIQEYVLDKINKRMQFTKAKQNKFNESGQFSVFYFFSCIWGTFIL     71 - 140
ISENCLSDPTLIWKARPHSMMTFQMKFFYISQLAYWFHAFPELYFQKTKKQDIPRQLVYIGLHLFHITGA    141 - 210
YLLYLNHLGLLLLVLHYFVELLSHMCGLFYFSDEKYQKGISLWAIVFILGRLVTLIVSVLTVGFHLAGSQ    211 - 280
NRNPDALTGNVNVLAAKIAVLSSSCTIQAYVTWNLITLWLQRWVEDSNIQASCMKKKRSRSSKKRTENGV    281 - 350
GVETSNRVDCPPKRKEKSS                                                       351 - 369
//

Text Mined References (9)

PMID Year Title