Property Summary

NCBI Gene PubMed Count 50
PubMed Score 59.19
PubTator Score 36.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
active Crohn's disease -3.756 4.4e-05
active ulcerative colitis -3.777 1.2e-04
adult high grade glioma -2.400 4.1e-04
astrocytoma -1.200 1.8e-06
atypical teratoid / rhabdoid tumor -3.000 3.0e-03
glioblastoma -1.800 1.4e-02
group 3 medulloblastoma -2.900 2.8e-04
head and neck cancer and chronic obstruc... -1.300 6.6e-03
interstitial cystitis -1.400 1.3e-02
intraductal papillary-mucinous adenoma (... -3.600 2.4e-04
intraductal papillary-mucinous carcinoma... -2.900 2.6e-02
intraductal papillary-mucinous neoplasm ... -4.100 2.0e-03
lung carcinoma 1.500 1.2e-11
medulloblastoma, large-cell -3.600 5.2e-04
oligodendroglioma -1.300 5.4e-06
ovarian cancer -3.900 1.2e-11
pancreatic cancer -1.600 3.5e-03
Pick disease -1.100 4.1e-02
primitive neuroectodermal tumor -2.000 5.0e-02
psoriasis -1.200 8.3e-13
urothelial carcinoma -1.900 7.3e-09

Gene RIF (39)

AA Sequence

MNQTASVSHHIKCQPSKTIKELGSNSPPQRNWKGIAIALLVILVVCSLITMSVILLTPDELTNSSETRLS      1 - 70
LEDLFRKDFVLHDPEARWINDTDVVYKSENGHVIKLNIETNATTLLLENTTFVTFKASRHSVSPDLKYVL     71 - 140
LAYDVKQIFHYSYTASYVIYNIHTREVWELNPPEVEDSVLQYAAWGVQGQQLIYIFENNIYYQPDIKSSS    141 - 210
LRLTSSGKEEIIFNGIADWLYEEELLHSHIAHWWSPDGERLAFLMINDSLVPTMVIPRFTGALYPKGKQY    211 - 280
PYPKAGQVNPTIKLYVVNLYGPTHTLELMPPDSFKSREYYITMVKWVSNTKTVVRWLNRAQNISILTVCE    281 - 350
TTTGACSKKYEMTSDTWLSQQNEEPVFSRDGSKFFMTVPVKQGGRGEFHHVAMFLIQSKSEQITVRHLTS    351 - 420
GNWEVIKILAYDETTQKIYFLSTESSPRGRQLYSASTEGLLNRQCISCNFMKEQCTYFDASFSPMNQHFL    421 - 490
LFCEGPRVPVVSLHSTDNPAKYFILESNSMLKEAILKKKIGKPEIKILHIDDYELPLQLSLPKDFMDRNQ    491 - 560
YALLLIMDEEPGGQLVTDKFHIDWDSVLIDMDNVIVARFDGRGSGFQGLKILQEIHRRLGSVEVKDQITA    561 - 630
VKFLLKLPYIDSKRLSIFGKGYGGYIASMILKSDEKLFKCGSVVAPITDLKLYASAFSERYLGMPSKEES    631 - 700
TYQAASVLHNVHGLKEENILIIHGTADTKVHFQHSAELIKHLIKAGVNYTMQVYPDEGHNVSEKSKYHLY    701 - 770
STILKFFSDCLKEEISVLPQEPEEDE                                                771 - 796
//

Text Mined References (52)

PMID Year Title