Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.37
PubTator Score 35.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 7.9e-07
psoriasis 6694 3.4e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Diphtheria 40 3.203 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.637 7.9e-07
psoriasis -1.500 3.4e-04

Gene RIF (2)

AA Sequence

MQPSGWAAAREAAGRDMLAADLRCSLFASALQSYKRDSVLRPFPASYARGDCKDFEALLADASKLPNLKE      1 - 70
LLQSSGDNHKRAWDLVSWILSSKVLTIHSAGKAEFEKIQKLTGAPHTPVPAPDFLFEIEYFDPANAKFYE     71 - 140
TKGERDLIYAFHGSRLENFHSIIHNGLHCHLNKTSLFGEGTYLTSDLSLALIYSPHGHGWQHSLLGPILS    141 - 210
CVAVCEVIDHPDVKCQTKKKDSKEIDRRRARIKHSEGGDIPPKYFVVTNNQLLRVKYLLVYSQKPPKRAS    211 - 280
SQLSWFSSHWFTVMISLYLLLLLIVSVINSSAFQHFWNRAKR                                281 - 322
//

Text Mined References (12)

PMID Year Title