Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.71
PubTator Score 35.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 7.89296946719153E-7
psoriasis 6685 3.36124227356629E-4

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis -1.500 0.000
osteosarcoma -1.637 0.000

Synonym

Accession Q8N5Y8 Q6PK64 Q9NX03
Symbols ARTD15
pART15
C15orf30

Gene

PDB

4F0D  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (2)

PMID Text
25037261 ARTD15 plays role in nucleocytoplasmic shuttling, through karyopherin-beta1 mono-ADP-ribosylation. [review]
23103912 PARP16 is a tail-anchored endoplasmic reticulum protein required for the PERK- and IRE1alpha-mediated unfolded protein response.

AA Sequence

MQPSGWAAAREAAGRDMLAADLRCSLFASALQSYKRDSVLRPFPASYARGDCKDFEALLADASKLPNLKE      1 - 70
LLQSSGDNHKRAWDLVSWILSSKVLTIHSAGKAEFEKIQKLTGAPHTPVPAPDFLFEIEYFDPANAKFYE     71 - 140
TKGERDLIYAFHGSRLENFHSIIHNGLHCHLNKTSLFGEGTYLTSDLSLALIYSPHGHGWQHSLLGPILS    141 - 210
CVAVCEVIDHPDVKCQTKKKDSKEIDRRRARIKHSEGGDIPPKYFVVTNNQLLRVKYLLVYSQKPPKRAS    211 - 280
SQLSWFSSHWFTVMISLYLLLLLIVSVINSSAFQHFWNRAKR                                281 - 322
//

Text Mined References (12)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25037261 2015 Regulation of nucleocytoplasmic transport by ADP-ribosylation: the emerging role of karyopherin-?1 mono-ADP-ribosylation by ARTD15.
23103912 2012 PARP16 is a tail-anchored endoplasmic reticulum protein required for the PERK- and IRE1?-mediated unfolded protein response.
22701565 2012 PARP16/ARTD15 is a novel endoplasmic-reticulum-associated mono-ADP-ribosyltransferase that interacts with, and modifies karyopherin-ß1.
22661712 2012 Crystal structure of human ADP-ribose transferase ARTD15/PARP16 reveals a novel putative regulatory domain.
20106667 2010 Toward a unified nomenclature for mammalian ADP-ribosyltransferases.
19946888 2010 Defining the membrane proteome of NK cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15273990 2004 The PARP superfamily.
More...