Property Summary

NCBI Gene PubMed Count 11
Grant Count 11
R01 Count 11
Funding $980,655.99
PubMed Score 9.93
PubTator Score 6.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
gastric cancer 1.200 0.001
psoriasis 1.100 0.000
osteosarcoma -2.575 0.000
glioblastoma -1.100 0.000
medulloblastoma -1.100 0.000
medulloblastoma, large-cell -1.100 0.002
intraductal papillary-mucinous carcinoma... 1.200 0.013
intraductal papillary-mucinous neoplasm ... 1.800 0.005
Breast cancer 3.700 0.024
ovarian cancer -1.200 0.000

Gene RIF (2)

PMID Text
20943666 MSL3 plays an important role in targeting the male specific lethal complex to chromatin in both humans and flies by binding to H4K20Me(1).
16227571 A multisubunit human histone acetylase complex that contains homologs of the Drosophila MSL proteins MOF, MSL1 (hampin A), MSL2, and MSL3 was described. This complex is responsible for histone H4 lysine-16 acetylation of all cellular chromosomes.

AA Sequence

MSASEGMKFKFHSGEKVLCFEPDPTKARVLYDAKIVDVIVGKDEKGRKIPEYLIHFNGWNRSWDRWAAED      1 - 70
HVLRDTDENRRLQRKLARKAVARLRSTGRKKKRCRLPGVDSVLKGLPTEEKDENDENSLSSSSDCSENKD     71 - 140
EEISEESDIEEKTEVKEEPELQTRREMEERTITIEIPEVLKKQLEDDCYYINRRKRLVKLPCQTNIITIL    141 - 210
ESYVKHFAINAAFSANERPRHHHVMPHANMNVHYIPAEKNVDLCKEMVDGLRITFDYTLPLVLLYPYEQA    211 - 280
QYKKVTSSKFFLPIKESATSTNRSQEELSPSPPLLNPSTPQSTESQPTTGEPATPKRRKAEPEALQSLRR    281 - 350
STRHSANCDRLSESSASPQPKRRQQDTSASMPKLFLHLEKKTPVHSRSSSPIPLTPSKEGSAVFAGFEGR    351 - 420
RTNEINEVLSWKLVPDNYPPGDQPPPPSYIYGAQHLLRLFVKLPEILGKMSFSEKNLKALLKHFDLFLRF    421 - 490
LAEYHDDFFPESAYVAACEAHYSTKNPRAIY                                           491 - 521
//

Text Mined References (21)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22547026 2012 Structural insight into the regulation of MOF in the male-specific lethal complex and the non-specific lethal complex.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21217699 2011 Structural basis for MOF and MSL3 recruitment into the dosage compensation complex by MSL1.
20943666 2010 Structural and biochemical studies on the chromo-barrel domain of male specific lethal 3 (MSL3) reveal a binding preference for mono- or dimethyllysine 20 on histone H4.
20657587 2010 Corecognition of DNA and a methylated histone tail by the MSL3 chromodomain.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20018852 2010 Subunit composition and substrate specificity of a MOF-containing histone acetyltransferase distinct from the male-specific lethal (MSL) complex.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
More...