Property Summary

NCBI Gene PubMed Count 11
PubMed Score 10.73
PubTator Score 6.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Breast cancer 3.700 2.4e-02
gastric cancer 1.200 1.0e-03
glioblastoma -1.100 1.4e-05
intraductal papillary-mucinous carcinoma... 1.200 1.3e-02
intraductal papillary-mucinous neoplasm ... 1.800 4.8e-03
medulloblastoma -1.100 8.1e-05
medulloblastoma, large-cell -1.100 1.7e-03
osteosarcoma -2.575 1.8e-08
ovarian cancer -1.200 4.5e-09
psoriasis 1.100 2.6e-04

Gene RIF (2)

AA Sequence

MSASEGMKFKFHSGEKVLCFEPDPTKARVLYDAKIVDVIVGKDEKGRKIPEYLIHFNGWNRSWDRWAAED      1 - 70
HVLRDTDENRRLQRKLARKAVARLRSTGRKKKRCRLPGVDSVLKGLPTEEKDENDENSLSSSSDCSENKD     71 - 140
EEISEESDIEEKTEVKEEPELQTRREMEERTITIEIPEVLKKQLEDDCYYINRRKRLVKLPCQTNIITIL    141 - 210
ESYVKHFAINAAFSANERPRHHHVMPHANMNVHYIPAEKNVDLCKEMVDGLRITFDYTLPLVLLYPYEQA    211 - 280
QYKKVTSSKFFLPIKESATSTNRSQEELSPSPPLLNPSTPQSTESQPTTGEPATPKRRKAEPEALQSLRR    281 - 350
STRHSANCDRLSESSASPQPKRRQQDTSASMPKLFLHLEKKTPVHSRSSSPIPLTPSKEGSAVFAGFEGR    351 - 420
RTNEINEVLSWKLVPDNYPPGDQPPPPSYIYGAQHLLRLFVKLPEILGKMSFSEKNLKALLKHFDLFLRF    421 - 490
LAEYHDDFFPESAYVAACEAHYSTKNPRAIY                                           491 - 521
//

Text Mined References (21)

PMID Year Title