Property Summary

NCBI Gene PubMed Count 7
PubMed Score 7.81
PubTator Score 6.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
adult high grade glioma -1.400 1.0e-04
astrocytic glioma -1.100 3.0e-02
Astrocytoma, Pilocytic -1.700 2.0e-08
atypical teratoid / rhabdoid tumor -1.600 2.5e-04
Breast cancer -1.700 9.3e-11
ductal carcinoma in situ -1.300 2.4e-04
ependymoma -1.700 4.5e-02
glioblastoma -1.700 2.4e-08
group 4 medulloblastoma 1.200 1.3e-02
hereditary spastic paraplegia -1.264 9.4e-03
invasive ductal carcinoma -1.800 8.8e-04
medulloblastoma, large-cell -1.400 2.4e-03
non-small cell lung cancer -1.102 3.4e-22
oligodendroglioma -1.400 3.3e-02
osteosarcoma -2.300 1.9e-05
ovarian cancer -1.400 1.6e-04
pancreatic cancer -1.600 2.9e-02
pancreatic carcinoma -1.600 2.9e-02
primitive neuroectodermal tumor -1.600 3.0e-03
tuberculosis 1.800 3.7e-08

Protein-protein Interaction (4)

Gene RIF (4)

AA Sequence

MALPPAAAPPAGAREPPGSRAAAAAAAPEPPLGLQQLSALQPEPGGVPLHSSWTFWLDRSLPGATAAECA      1 - 70
SNLKKIYTVQTVQIFWSVYNNIPPVTSLPLRCSYHLMRGERRPLWEEESNAKGGVWKMKVPKDSTSTVWK     71 - 140
ELLLATIGEQFTDCAAADDEVIGVSVSVRDREDVVQVWNVNASLVGEATVLEKIYELLPHITFKAVFYKP    141 - 210
HEEHHAFEGGRGKH                                                            211 - 224
//

Text Mined References (10)

PMID Year Title