Property Summary

NCBI Gene PubMed Count 6
Grant Count 5
R01 Count 5
Funding $616,285.67
PubMed Score 7.46
PubTator Score 6.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
pancreatic cancer -1.600 0.029
astrocytic glioma -2.000 0.007
ependymoma -1.700 0.045
oligodendroglioma -1.500 0.000
glioblastoma -1.900 0.000
osteosarcoma -2.300 0.000
sonic hedgehog group medulloblastoma -1.700 0.000
atypical teratoid / rhabdoid tumor -1.600 0.000
medulloblastoma, large-cell -1.400 0.002
primitive neuroectodermal tumor -1.600 0.003
hereditary spastic paraplegia -1.264 0.009
tuberculosis 1.800 0.000
non-small cell lung cancer -1.419 0.000
adult high grade glioma -2.200 0.000
pilocytic astrocytoma -1.700 0.000
pancreatic carcinoma -1.600 0.029
Breast cancer -1.700 0.000
ductal carcinoma in situ -1.300 0.000
invasive ductal carcinoma -1.800 0.001
ovarian cancer -1.500 0.000

Gene RIF (3)

PMID Text
25403230 MNK1 and MNK2 inhibition ablates eIF4E1 phosphorylation and concurrently enhances eIF4E3 expression in diffuse large B-cell lymphoma.
23587918 eIF4E3 impedes oncogenic transformation and its expression is lost in some cancers.
23333304 HIV-1 Vif upregulates the expression of eukaryotic translation initiation factor 4E family member 3 (EIF4E3) in Vif-expression T cells

AA Sequence

MALPPAAAPPAGAREPPGSRAAAAAAAPEPPLGLQQLSALQPEPGGVPLHSSWTFWLDRSLPGATAAECA      1 - 70
SNLKKIYTVQTVQIFWSVYNNIPPVTSLPLRCSYHLMRGERRPLWEEESNAKGGVWKMKVPKDSTSTVWK     71 - 140
ELLLATIGEQFTDCAAADDEVIGVSVSVRDREDVVQVWNVNASLVGEATVLEKIYELLPHITFKAVFYKP    141 - 210
HEEHHAFEGGRGKH                                                            211 - 224
//

Text Mined References (9)

PMID Year Title
25403230 2014 MNKs act as a regulatory switch for eIF4E1 and eIF4E3 driven mRNA translation in DLBCL.
23587918 2013 eIF4E3, a new actor in mRNA metabolism and tumor suppression.
23431134 2013 eIF4E3 acts as a tumor suppressor by utilizing an atypical mode of methyl-7-guanosine cap recognition.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15153109 2004 Characterization of mammalian eIF4E-family members.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.