Property Summary

NCBI Gene PubMed Count 6
PubMed Score 7.46
PubTator Score 6.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
non-small cell lung cancer 2798 1.63394633059085E-18
oligodendroglioma 2849 2.21870226692188E-17
Breast cancer 3099 9.28455449209543E-11
pilocytic astrocytoma 3086 2.73662244003414E-8
tuberculosis 1563 3.66237149834726E-8
glioblastoma 5572 3.87460132752351E-7
adult high grade glioma 2148 5.27345536232615E-7
osteosarcoma 7933 1.85761608802064E-5
sonic hedgehog group medulloblastoma 1482 3.9310488624311E-5
ductal carcinoma in situ 1745 2.39848604427089E-4
atypical teratoid / rhabdoid tumor 4369 2.53678611602064E-4
ovarian cancer 8492 2.95446980788725E-4
invasive ductal carcinoma 2950 8.84138184467229E-4
medulloblastoma, large-cell 6234 0.00241521862082406
primitive neuroectodermal tumor 3031 0.00300963291286635
astrocytic glioma 2241 0.00677870300617223
hereditary spastic paraplegia 313 0.00937987993701432
pancreatic cancer 2300 0.0285021219265784
pancreatic carcinoma 567 0.0285021219265786
ependymoma 2514 0.0446298165080536
Disease Target Count Z-score Confidence
Obesity 616 0.0 1.0
Disease Target Count Z-score Confidence
Blepharophimosis 17 4.231 2.1

Expression

  Differential Expression (20)

Disease log2 FC p
pancreatic cancer -1.600 0.029
astrocytic glioma -2.000 0.007
ependymoma -1.700 0.045
oligodendroglioma -1.500 0.000
glioblastoma -1.900 0.000
osteosarcoma -2.300 0.000
sonic hedgehog group medulloblastoma -1.700 0.000
atypical teratoid / rhabdoid tumor -1.600 0.000
medulloblastoma, large-cell -1.400 0.002
primitive neuroectodermal tumor -1.600 0.003
hereditary spastic paraplegia -1.264 0.009
tuberculosis 1.800 0.000
non-small cell lung cancer -1.419 0.000
adult high grade glioma -2.200 0.000
pilocytic astrocytoma -1.700 0.000
pancreatic carcinoma -1.600 0.029
Breast cancer -1.700 0.000
ductal carcinoma in situ -1.300 0.000
invasive ductal carcinoma -1.800 0.001
ovarian cancer -1.500 0.000

Synonym

Accession Q8N5X7 B2R963 Q6NUT1 eIF-4E type 3
Symbols eIF-4E3
eIF4E-3

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard EggNOG Inparanoid
Xenopus OMA EggNOG

Gene RIF (3)

PMID Text
25403230 MNK1 and MNK2 inhibition ablates eIF4E1 phosphorylation and concurrently enhances eIF4E3 expression in diffuse large B-cell lymphoma.
23587918 eIF4E3 impedes oncogenic transformation and its expression is lost in some cancers.
23333304 HIV-1 Vif upregulates the expression of eukaryotic translation initiation factor 4E family member 3 (EIF4E3) in Vif-expression T cells

AA Sequence

MALPPAAAPPAGAREPPGSRAAAAAAAPEPPLGLQQLSALQPEPGGVPLHSSWTFWLDRSLPGATAAECA      1 - 70
SNLKKIYTVQTVQIFWSVYNNIPPVTSLPLRCSYHLMRGERRPLWEEESNAKGGVWKMKVPKDSTSTVWK     71 - 140
ELLLATIGEQFTDCAAADDEVIGVSVSVRDREDVVQVWNVNASLVGEATVLEKIYELLPHITFKAVFYKP    141 - 210
HEEHHAFEGGRGKH                                                            211 - 224
//

Text Mined References (9)

PMID Year Title
25403230 2014 MNKs act as a regulatory switch for eIF4E1 and eIF4E3 driven mRNA translation in DLBCL.
23587918 2013 eIF4E3, a new actor in mRNA metabolism and tumor suppression.
23431134 2013 eIF4E3 acts as a tumor suppressor by utilizing an atypical mode of methyl-7-guanosine cap recognition.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15153109 2004 Characterization of mammalian eIF4E-family members.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.