Property Summary

NCBI Gene PubMed Count 19
Grant Count 26
R01 Count 21
Funding $1,783,893
PubMed Score 14.43
PubTator Score 7.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
astrocytic glioma -2.700 0.003
ependymoma -2.200 0.030
glioblastoma multiforme -2.800 0.000
oligodendroglioma -2.700 0.000
osteosarcoma 2.144 0.011
medulloblastoma -3.400 0.000
atypical teratoid / rhabdoid tumor -3.000 0.000
medulloblastoma, large-cell -4.300 0.001
primitive neuroectodermal tumor -2.300 0.006
adrenocortical carcinoma -1.992 0.038
non-small cell lung cancer 1.485 0.000
intraductal papillary-mucinous adenoma (... 1.100 0.000
adult high grade glioma -2.100 0.034
pilocytic astrocytoma -1.400 0.044
aldosterone-producing adenoma -1.285 0.007
lung adenocarcinoma 1.600 0.000
Pick disease -1.400 0.032
ulcerative colitis -1.100 0.001
ovarian cancer 1.200 0.001

Gene RIF (5)

PMID Text
26340433 A visceral-fat-associated SNP, rs11678490 of NGEF, was found in Korean men.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19911011 Observational study of gene-disease association. (HuGE Navigator)
18976975 Knockdown of neuronal guanine nucleotide exchange factor (NGEF) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
17702745 FGFR-mediated phosphorylation of ephexin1 enhances the guanine nucleotide exchange activity toward RhoA without affecting the activity to Rac1 or Cdc42.

AA Sequence

METRESEDLEKTRRKSASDQWNTDNEPAKVKPELLPEKEETSQADQDIQDKEPHCHIPIKRNSIFNRSIR      1 - 70
RKSKAKARDNPERNASCLADSQDNGKSVNEPLTLNIPWSRMPPCRTAMQTDPGAQEMSESSSTPGNGATP     71 - 140
EEWPALADSPTTLTEALRMIHPIPADSWRNLIEQIGLLYQEYRDKSTLQEIETRRQQDAEIEDNTNGSPA    141 - 210
SEDTPEEEEEEEEEEEPASPPERKTLPQICLLSNPHSRFNLWQDLPEIRSSGVLEILQPEEIKLQEAMFE    211 - 280
LVTSEASYYKSLNLLVSHFMENERIRKILHPSEAHILFSNVLDVLAVSERFLLELEHRMEENIVISDVCD    281 - 350
IVYRYAADHFSVYITYVSNQTYQERTYKQLLQEKAAFRELIAQLELDPKCRGLPFSSFLILPFQRITRLK    351 - 420
LLVQNILKRVEERSERECTALDAHKELEMVVKACNEGVRKMSRTEQMISIQKKMEFKIKSVPIISHSRWL    421 - 490
LKQGELQQMSGPKTSRTLRTKKLFHEIYLFLFNDLLVICRQIPGDKYQVFDSAPRGLLRVEELEDQGQTL    491 - 560
ANVFILRLLENADDREATYMLKASSQSEMKRWMTSLAPNRRTKFVSFTSRLLDCPQVQCVHPYVAQQPDE    561 - 630
LTLELADILNILDKTDDGWIFGERLHDQERGWFPSSMTEEILNPKIRSQNLKECFRVHKMDDPQRSQNKD    631 - 700
RRKLGSRNRQ                                                                701 - 710
//

Text Mined References (21)

PMID Year Title
26340433 2015 A Common Variant of NGEF Is Associated with Abdominal Visceral Fat in Korean Men.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24152035 2014 Variants in the 1q21 risk region are associated with a visual endophenotype of autism and schizophrenia.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
21789175 2011 Identification and analysis of intermediate size noncoding RNAs in the human fetal brain.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19911011 2010 Mutation of ARHGAP9 in patients with coronary spastic angina.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17702745 2007 Regulation of ephexin1, a guanine nucleotide exchange factor of Rho family GTPases, by fibroblast growth factor receptor-mediated tyrosine phosphorylation.
More...