Property Summary

NCBI Gene PubMed Count 15
Grant Count 1
Funding $314,133.78
PubMed Score 6.31
PubTator Score 6.42

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis -1.700 0.000
osteosarcoma -3.528 0.000
lung cancer -1.200 0.000
spina bifida -1.083 0.042
ovarian cancer 1.400 0.000

Synonym

Accession Q8N5U6 Q92550 Q9NPP8 Q9ULW4
Symbols RIE2

Gene

 Grant Application (1)

Pathway (1)

Gene RIF (4)

PMID Text
24151200 CYB5A, which has a role in stearyl-CoA-desaturase activity, and RNF10, with an unknown role in weight regulating pathways, associated with adiposity and nominally increased the risk for T2D in American Indians.
18941509 RNF10 is a trans-acting protein regulating MAG expression and is required for myelin formation.
18854154 Knockdown of ring finger protein 10 (RNF10) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
16335786 MEOX2 and Meox2 binding to RNF10 protein was characterized.

AA Sequence

MPLSSPNAAATASDMDKNSGSNSSSASSGSSKGQQPPRSASAGPAGESKPKSDGKNSSGSKRYNRKRELS      1 - 70
YPKNESFNNQSRRSSSQKSKTFNKMPPQRGGGSSKLFSSSFNGGRRDEVAEAQRAEFSPAQFSGPKKINL     71 - 140
NHLLNFTFEPRGQTGHFEGSGHGSWGKRNKWGHKPFNKELFLQANCQFVVSEDQDYTAHFADPDTLVNWD    141 - 210
FVEQVRICSHEVPSCPICLYPPTAAKITRCGHIFCWACILHYLSLSEKTWSKCPICYSSVHKKDLKSVVA    211 - 280
TESHQYVVGDTITMQLMKREKGVLVALPKSKWMNVDHPIHLGDEQHSQYSKLLLASKEQVLHRVVLEEKV    281 - 350
ALEQQLAEEKHTPESCFIEAAIQELKTREEALSGLAGSRREVTGVVAALEQLVLMAPLAKESVFQPRKGV    351 - 420
LEYLSAFDEETTEVCSLDTPSRPLALPLVEEEEAVSEPEPEGLPEACDDLELADDNLKEGTICTESSQQE    421 - 490
PITKSGFTRLSSSPCYYFYQAEDGQHMFLHPVNVRCLVREYGSLERSPEKISATVVEIAGYSMSEDVRQR    491 - 560
HRYLSHLPLTCEFSICELALQPPVVSKETLEMFSDDIEKRKRQRQKKAREERRRERRIEIEENKKQGKYP    561 - 630
EVHIPLENLQQFPAFNSYTCSSDSALGPTSTEGHGALSISPLSRSPGSHADFLLTPLSPTASQGSPSFCV    631 - 700
GSLEEDSPFPSFAQMLRVGKAKADVWPKTAPKKDENSLVPPAPVDSDGESDNSDRVPVPSFQNSFSQAIE    701 - 770
AAFMKLDTPATSDPLSEEKGGKKRKKQKQKLLFSTSVVHTK                                 771 - 811
//

Text Mined References (16)

PMID Year Title
24151200 2014 Whole exome sequencing identifies variation in CYB5A and RNF10 associated with adiposity and type 2 diabetes.
24105792 2014 Protein microarray characterization of the S-nitrosoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23028342 2012 New susceptibility loci associated with kidney disease in type 1 diabetes.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
18941509 2008 A novel function of RING finger protein 10 in transcriptional regulation of the myelin-associated glycoprotein gene and myelin formation in Schwann cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
16335786 2005 Characterization of Mesenchyme Homeobox 2 (MEOX2) transcription factor binding to RING finger protein 10.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
More...