Property Summary

NCBI Gene PubMed Count 15
PubMed Score 6.53
PubTator Score 6.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 3.4e-08
osteosarcoma 7950 3.6e-06
psoriasis 6694 3.2e-05
lung cancer 4740 2.3e-04
spina bifida 1074 4.2e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.5

Expression

  Differential Expression (5)

Disease log2 FC p
lung cancer -1.200 2.3e-04
osteosarcoma -3.528 3.6e-06
ovarian cancer -1.300 3.4e-08
psoriasis -1.700 3.2e-05
spina bifida -1.083 4.2e-02

Gene RIF (4)

AA Sequence

MPLSSPNAAATASDMDKNSGSNSSSASSGSSKGQQPPRSASAGPAGESKPKSDGKNSSGSKRYNRKRELS      1 - 70
YPKNESFNNQSRRSSSQKSKTFNKMPPQRGGGSSKLFSSSFNGGRRDEVAEAQRAEFSPAQFSGPKKINL     71 - 140
NHLLNFTFEPRGQTGHFEGSGHGSWGKRNKWGHKPFNKELFLQANCQFVVSEDQDYTAHFADPDTLVNWD    141 - 210
FVEQVRICSHEVPSCPICLYPPTAAKITRCGHIFCWACILHYLSLSEKTWSKCPICYSSVHKKDLKSVVA    211 - 280
TESHQYVVGDTITMQLMKREKGVLVALPKSKWMNVDHPIHLGDEQHSQYSKLLLASKEQVLHRVVLEEKV    281 - 350
ALEQQLAEEKHTPESCFIEAAIQELKTREEALSGLAGSRREVTGVVAALEQLVLMAPLAKESVFQPRKGV    351 - 420
LEYLSAFDEETTEVCSLDTPSRPLALPLVEEEEAVSEPEPEGLPEACDDLELADDNLKEGTICTESSQQE    421 - 490
PITKSGFTRLSSSPCYYFYQAEDGQHMFLHPVNVRCLVREYGSLERSPEKISATVVEIAGYSMSEDVRQR    491 - 560
HRYLSHLPLTCEFSICELALQPPVVSKETLEMFSDDIEKRKRQRQKKAREERRRERRIEIEENKKQGKYP    561 - 630
EVHIPLENLQQFPAFNSYTCSSDSALGPTSTEGHGALSISPLSRSPGSHADFLLTPLSPTASQGSPSFCV    631 - 700
GSLEEDSPFPSFAQMLRVGKAKADVWPKTAPKKDENSLVPPAPVDSDGESDNSDRVPVPSFQNSFSQAIE    701 - 770
AAFMKLDTPATSDPLSEEKGGKKRKKQKQKLLFSTSVVHTK                                 771 - 811
//

Text Mined References (16)

PMID Year Title