Property Summary

NCBI Gene PubMed Count 15
PubMed Score 6.31
PubTator Score 6.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 2.63088739716509E-7
osteosarcoma 7933 3.63555522564045E-6
psoriasis 6685 3.1564801959766E-5
lung cancer 4473 2.3011649064296E-4
spina bifida 1064 0.0418370570701565

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis -1.700 0.000
osteosarcoma -3.528 0.000
lung cancer -1.200 0.000
spina bifida -1.083 0.042
ovarian cancer 1.400 0.000

Synonym

Accession Q8N5U6 Q92550 Q9NPP8 Q9ULW4
Symbols RIE2

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
S.cerevisiae EggNOG Inparanoid

Pathway (1)

Gene RIF (4)

PMID Text
24151200 CYB5A, which has a role in stearyl-CoA-desaturase activity, and RNF10, with an unknown role in weight regulating pathways, associated with adiposity and nominally increased the risk for T2D in American Indians.
18941509 RNF10 is a trans-acting protein regulating MAG expression and is required for myelin formation.
18854154 Knockdown of ring finger protein 10 (RNF10) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
16335786 MEOX2 and Meox2 binding to RNF10 protein was characterized.

AA Sequence

MPLSSPNAAATASDMDKNSGSNSSSASSGSSKGQQPPRSASAGPAGESKPKSDGKNSSGSKRYNRKRELS      1 - 70
YPKNESFNNQSRRSSSQKSKTFNKMPPQRGGGSSKLFSSSFNGGRRDEVAEAQRAEFSPAQFSGPKKINL     71 - 140
NHLLNFTFEPRGQTGHFEGSGHGSWGKRNKWGHKPFNKELFLQANCQFVVSEDQDYTAHFADPDTLVNWD    141 - 210
FVEQVRICSHEVPSCPICLYPPTAAKITRCGHIFCWACILHYLSLSEKTWSKCPICYSSVHKKDLKSVVA    211 - 280
TESHQYVVGDTITMQLMKREKGVLVALPKSKWMNVDHPIHLGDEQHSQYSKLLLASKEQVLHRVVLEEKV    281 - 350
ALEQQLAEEKHTPESCFIEAAIQELKTREEALSGLAGSRREVTGVVAALEQLVLMAPLAKESVFQPRKGV    351 - 420
LEYLSAFDEETTEVCSLDTPSRPLALPLVEEEEAVSEPEPEGLPEACDDLELADDNLKEGTICTESSQQE    421 - 490
PITKSGFTRLSSSPCYYFYQAEDGQHMFLHPVNVRCLVREYGSLERSPEKISATVVEIAGYSMSEDVRQR    491 - 560
HRYLSHLPLTCEFSICELALQPPVVSKETLEMFSDDIEKRKRQRQKKAREERRRERRIEIEENKKQGKYP    561 - 630
EVHIPLENLQQFPAFNSYTCSSDSALGPTSTEGHGALSISPLSRSPGSHADFLLTPLSPTASQGSPSFCV    631 - 700
GSLEEDSPFPSFAQMLRVGKAKADVWPKTAPKKDENSLVPPAPVDSDGESDNSDRVPVPSFQNSFSQAIE    701 - 770
AAFMKLDTPATSDPLSEEKGGKKRKKQKQKLLFSTSVVHTK                                 771 - 811
//

Text Mined References (16)

PMID Year Title
24151200 2014 Whole exome sequencing identifies variation in CYB5A and RNF10 associated with adiposity and type 2 diabetes.
24105792 2014 Protein microarray characterization of the S-nitrosoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23028342 2012 New susceptibility loci associated with kidney disease in type 1 diabetes.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
18941509 2008 A novel function of RING finger protein 10 in transcriptional regulation of the myelin-associated glycoprotein gene and myelin formation in Schwann cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
16335786 2005 Characterization of Mesenchyme Homeobox 2 (MEOX2) transcription factor binding to RING finger protein 10.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
More...