Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
ovarian cancer 8,484

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.100 0.000

Synonym

Accession Q8N5U0
Symbols

Gene

 Compartment GO Term (1)

AA Sequence

MLVGTPNLLTLDEADATWTLIKDKVIEEHFGPNAVAVPFLSDAACYDLLGVLVKQSRPAHTRLALPGRQG      1 - 70
RRALKPVGPLPSLLEQAGSEGAFAHCTREYSPNGRAERAYEETRMLDGQPCKIRLHMGDLRKKVAFLLLP     71 - 140
PGQVSLQQTLPWLRSTHSIYVIYQVFSCSWLQLGLTSTAREPQLLRLLRSLPVAFSCLKFSLQSKGVLGP    141 - 210
QKPLTKDPLPHGANWVRPNLSIMPPLAPTSAPADTTEAADVPPPVPAPPTPPPQEGPEDKPTRFSYKGRN    211 - 280
PFWRGPQILSENWLFSPRSPPPGAQGGGPRDPDGHSMSLPLLQGLSSEFDSDD                     281 - 333
//

Text Mined References (2)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.