Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
malignant mesothelioma 3232 3.4e-08
cystic fibrosis 1696 3.7e-06
group 3 medulloblastoma 4104 4.1e-06
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (3)

Disease log2 FC p
cystic fibrosis -1.636 3.7e-06
group 3 medulloblastoma 1.200 4.1e-06
malignant mesothelioma -2.400 3.4e-08

Synonym

Accession Q8N5T2 B9A6M0 Q9NUX1
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

 Compartment GO Term (2)

AA Sequence

MLQEESDLSLIIAQIVQKLKGSNLYSQLERQAWASLQRPEIKLESLKEDIKEFFKISGWEKKLQNAVYSE      1 - 70
LSVFPLPSHPAAPPEHLKEPLVYMRKAQGSWEKRILKSLNSMCTELSIPLARKRPVGEQKELLNKWNEMG     71 - 140
TDEPDLSLFRPVYAPKDFLEVLINLRNPNYENGDSLSFRTHLGLIQVPLKVKDIPELKECFVELGLNIGQ    141 - 210
LGIDDSTQVPPELFENEHVRIGQKVLAEQDSAAAQQYIRQGSPTALRAELWALILNISSQPEDVLYYEQL    211 - 280
KTNVIQHDLLVDSLIYKDVKLTASNDDYYFVFEDYLYQVLLCFSRDTSVLSHFAFNSASPPKSYIRGKLG    281 - 350
LEEYAVFYPPNGVIPFHGFSMYVAPLCFLYHEPSKLYQIFREMYVRFFFRLHSISSHPSGIVSLCLLFET    351 - 420
LLQTYLPQLFYHLREIGAQPLRISFKWMVRAFSGYLATDQLLLLWDRILGYNSLEILAVLAAAVFAFRAV    421 - 490
NLMEVTSLAAAEAVLADLSTLKVMPLLQIFLFATVT                                      491 - 526
//

Text Mined References (10)

PMID Year Title