Property Summary

NCBI Gene PubMed Count 26
Grant Count 3
Funding $73,507.5
PubMed Score 2.22
PubTator Score 24.30

Knowledge Summary

Patent (1,694)

Expression

  Differential Expression (9)

Disease log2 FC p
oligodendroglioma -1.100 0.000
ependymoma -1.600 0.000
glioblastoma -2.200 0.000
atypical teratoid / rhabdoid tumor -2.300 0.000
medulloblastoma -1.100 0.041
medulloblastoma, large-cell -1.200 0.015
primitive neuroectodermal tumor -1.700 0.000
pediatric high grade glioma -1.600 0.000
pilocytic astrocytoma -1.800 0.000

 GWAS Trait (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (9)

PMID Text
27151216 Site-directed mutagenesis analysis revealed that Leu(358) in CaMKKbeta/Ile(322) in CaMKKalpha confer, at least in part, a distinct recognition of AMPK but not of CaMKIalpha.
25679868 CaMKK1 does not play a pivotal role in the calcium signaling cascade regulating adrenal aldosterone production.
23737288 CAMKK1 might contribute to the risk of lung cancer in Chinese populations.
20453000 Observational study of gene-disease association. (HuGE Navigator)
20106900 Observational study of gene-disease association. (HuGE Navigator)
19520843 Adiponectin activates AMP-activated protein kinase in muscle cells via APPL1/LKB1-dependent and phospholipase C/Ca2+/Ca2+/calmodulin-dependent protein kinase kinase-dependent pathways
18695047 CaMKIalpha is a widely expressed protein kinase, suggesting that Ca2+ is likely to be functionally important in the control of mitochondrial dynamics through regulation of Drp1 phosphorylation in neurons and other cell types.[CaMKIalpha]
18270593 role for CaMKKalpha in the differentiation of monocytic cells
16741161 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MEGGPAVCCQDPRAELVERVAAIDVTHLEEADGGPEPTRNGVDPPPRARAASVIPGSTSRLLPARPSLSA      1 - 70
RKLSLQERPAGSYLEAQAGPYATGPASHISPRAWRRPTIESHHVAISDAEDCVQLNQYKLQSEIGKGAYG     71 - 140
VVRLAYNESEDRHYAMKVLSKKKLLKQYGFPRRPPPRGSQAAQGGPAKQLLPLERVYQEIAILKKLDHVN    141 - 210
VVKLIEVLDDPAEDNLYLVFDLLRKGPVMEVPCDKPFSEEQARLYLRDVILGLEYLHCQKIVHRDIKPSN    211 - 280
LLLGDDGHVKIADFGVSNQFEGNDAQLSSTAGTPAFMAPEAISDSGQSFSGKALDVWATGVTLYCFVYGK    281 - 350
CPFIDDFILALHRKIKNEPVVFPEEPEISEELKDLILKMLDKNPETRIGVPDIKLHPWVTKNGEEPLPSE    351 - 420
EEHCSVVEVTEEEVKNSVRLIPSWTTVILVKSMLRKRSFGNPFEPQARREERSMSAPGNLLVKEGFGEGG    421 - 490
KSPELPGVQEDEAAS                                                           491 - 505
//

Text Mined References (33)

PMID Year Title
27151216 2016 Differential AMP-activated Protein Kinase (AMPK) Recognition Mechanism of Ca2+/Calmodulin-dependent Protein Kinase Kinase Isoforms.
25679868 2015 Role of Ca(2+)/calmodulin-dependent protein kinase kinase in adrenal aldosterone production.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23737288 2013 Polymorphism rs7214723 in CAMKK1 and lung cancer risk in Chinese population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20106900 2010 International Lung Cancer Consortium: coordinated association study of 10 potential lung cancer susceptibility variants.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19520843 2009 Adiponectin activates AMP-activated protein kinase in muscle cells via APPL1/LKB1-dependent and phospholipase C/Ca2+/Ca2+/calmodulin-dependent protein kinase kinase-dependent pathways.
More...