Property Summary

NCBI Gene PubMed Count 26
PubMed Score 2.22
PubTator Score 24.30

Knowledge Summary

Patent (1,694)

TINX Plot

  Disease Sources (2)

Disease Target Count
nervous system disorder 53
Disease Target Count P-value
oligodendroglioma 2849 2.32957592966187E-19
ependymoma 2514 9.38387928633997E-13
atypical teratoid / rhabdoid tumor 4369 9.55891280717737E-12
glioblastoma 5572 3.40140061064201E-8
pilocytic astrocytoma 3086 2.72499806921753E-7
pediatric high grade glioma 2712 3.44818101223538E-6
primitive neuroectodermal tumor 3031 8.49288183011107E-5
medulloblastoma, large-cell 6234 0.0151451387361908
medulloblastoma 1524 0.0414123648971217

Expression

  Differential Expression (9)

Disease log2 FC p
oligodendroglioma -1.100 0.000
ependymoma -1.600 0.000
glioblastoma -2.200 0.000
atypical teratoid / rhabdoid tumor -2.300 0.000
medulloblastoma -1.100 0.041
medulloblastoma, large-cell -1.200 0.015
primitive neuroectodermal tumor -1.700 0.000
pediatric high grade glioma -1.600 0.000
pilocytic astrocytoma -1.800 0.000

Synonym

Accession Q8N5S9 Q9BQH3 CaM-KK 1
Symbols CAMKKA

Gene

  Ortholog (11)

 Collection (1)

 GWAS Trait (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (9)

PMID Text
27151216 Site-directed mutagenesis analysis revealed that Leu(358) in CaMKKbeta/Ile(322) in CaMKKalpha confer, at least in part, a distinct recognition of AMPK but not of CaMKIalpha.
25679868 CaMKK1 does not play a pivotal role in the calcium signaling cascade regulating adrenal aldosterone production.
23737288 CAMKK1 might contribute to the risk of lung cancer in Chinese populations.
20453000 Observational study of gene-disease association. (HuGE Navigator)
20106900 Observational study of gene-disease association. (HuGE Navigator)
19520843 Adiponectin activates AMP-activated protein kinase in muscle cells via APPL1/LKB1-dependent and phospholipase C/Ca2+/Ca2+/calmodulin-dependent protein kinase kinase-dependent pathways
18695047 CaMKIalpha is a widely expressed protein kinase, suggesting that Ca2+ is likely to be functionally important in the control of mitochondrial dynamics through regulation of Drp1 phosphorylation in neurons and other cell types.[CaMKIalpha]
18270593 role for CaMKKalpha in the differentiation of monocytic cells
16741161 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MEGGPAVCCQDPRAELVERVAAIDVTHLEEADGGPEPTRNGVDPPPRARAASVIPGSTSRLLPARPSLSA      1 - 70
RKLSLQERPAGSYLEAQAGPYATGPASHISPRAWRRPTIESHHVAISDAEDCVQLNQYKLQSEIGKGAYG     71 - 140
VVRLAYNESEDRHYAMKVLSKKKLLKQYGFPRRPPPRGSQAAQGGPAKQLLPLERVYQEIAILKKLDHVN    141 - 210
VVKLIEVLDDPAEDNLYLVFDLLRKGPVMEVPCDKPFSEEQARLYLRDVILGLEYLHCQKIVHRDIKPSN    211 - 280
LLLGDDGHVKIADFGVSNQFEGNDAQLSSTAGTPAFMAPEAISDSGQSFSGKALDVWATGVTLYCFVYGK    281 - 350
CPFIDDFILALHRKIKNEPVVFPEEPEISEELKDLILKMLDKNPETRIGVPDIKLHPWVTKNGEEPLPSE    351 - 420
EEHCSVVEVTEEEVKNSVRLIPSWTTVILVKSMLRKRSFGNPFEPQARREERSMSAPGNLLVKEGFGEGG    421 - 490
KSPELPGVQEDEAAS                                                           491 - 505
//

Text Mined References (33)

PMID Year Title
27151216 2016 Differential AMP-activated Protein Kinase (AMPK) Recognition Mechanism of Ca2+/Calmodulin-dependent Protein Kinase Kinase Isoforms.
25679868 2015 Role of Ca(2+)/calmodulin-dependent protein kinase kinase in adrenal aldosterone production.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23737288 2013 Polymorphism rs7214723 in CAMKK1 and lung cancer risk in Chinese population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20106900 2010 International Lung Cancer Consortium: coordinated association study of 10 potential lung cancer susceptibility variants.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19520843 2009 Adiponectin activates AMP-activated protein kinase in muscle cells via APPL1/LKB1-dependent and phospholipase C/Ca2+/Ca2+/calmodulin-dependent protein kinase kinase-dependent pathways.
More...