Property Summary

Ligand Count 4
NCBI Gene PubMed Count 26
PubMed Score 4.10
PubTator Score 24.30

Knowledge Summary

Patent (1,694)

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.400 1.9e-03
Astrocytoma, Pilocytic -1.800 1.8e-07
atypical teratoid / rhabdoid tumor -2.300 9.6e-12
ependymoma -1.600 9.4e-13
glioblastoma -1.400 9.4e-08
group 4 medulloblastoma -1.100 7.6e-03
medulloblastoma, large-cell -1.200 1.5e-02
oligodendroglioma -1.100 2.3e-19
primitive neuroectodermal tumor -1.700 8.5e-05

 GWAS Trait (1)

Protein-protein Interaction (2)

Gene RIF (9)

AA Sequence

MEGGPAVCCQDPRAELVERVAAIDVTHLEEADGGPEPTRNGVDPPPRARAASVIPGSTSRLLPARPSLSA      1 - 70
RKLSLQERPAGSYLEAQAGPYATGPASHISPRAWRRPTIESHHVAISDAEDCVQLNQYKLQSEIGKGAYG     71 - 140
VVRLAYNESEDRHYAMKVLSKKKLLKQYGFPRRPPPRGSQAAQGGPAKQLLPLERVYQEIAILKKLDHVN    141 - 210
VVKLIEVLDDPAEDNLYLVFDLLRKGPVMEVPCDKPFSEEQARLYLRDVILGLEYLHCQKIVHRDIKPSN    211 - 280
LLLGDDGHVKIADFGVSNQFEGNDAQLSSTAGTPAFMAPEAISDSGQSFSGKALDVWATGVTLYCFVYGK    281 - 350
CPFIDDFILALHRKIKNEPVVFPEEPEISEELKDLILKMLDKNPETRIGVPDIKLHPWVTKNGEEPLPSE    351 - 420
EEHCSVVEVTEEEVKNSVRLIPSWTTVILVKSMLRKRSFGNPFEPQARREERSMSAPGNLLVKEGFGEGG    421 - 490
KSPELPGVQEDEAAS                                                           491 - 505
//

Text Mined References (33)

PMID Year Title