Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.13
PubTator Score 0.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
active Crohn's disease 1.073 1.7e-02
Breast cancer 3.700 2.5e-02
hepatocellular carcinoma 1.100 2.9e-04
intraductal papillary-mucinous neoplasm ... 1.600 2.8e-03
ovarian cancer 1.200 7.3e-03
pediatric high grade glioma 1.200 1.0e-04
tuberculosis -1.100 8.1e-05

Gene RIF (1)

AA Sequence

MAARSVSGITRRVFMWTVSGTPCREFWSRFRKEKEPVVVETVEEKKEPILVCPPLRSRAYTPPEDLQSRL      1 - 70
ESYVKEVFGSSLPSNWQDISLEDSRLKFNLLAHLADDLGHVVPNSRLHQMCRVRDVLDFYNVPIQDRSKF     71 - 140
DELSASNLPPNLKITWSY                                                        141 - 158
//

Text Mined References (12)

PMID Year Title