Property Summary

NCBI Gene PubMed Count 8
Grant Count 1
Funding $109,074
PubMed Score 3.81
PubTator Score 8.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.200 0.001

Synonym

Accession Q8N5M9 Q8NCF6 Q96SW1
Symbols SCN6
GL009

Gene

 Grant Application (1)

Gene RIF (2)

PMID Text
25129145 Data directly identify Jagn1 (JAGN1 in humans) as a new regulator of neutrophil function in microbial pathogenesis.
25129144 JAGN1 participates in the secretory pathway and is required for granulocyte colony-stimulating factor receptor-mediated signaling. JAGN1 emerges as a factor that is necessary in the differentiation and survival of neutrophils.

AA Sequence

MASRAGPRAAGTDGSDFQHRERVAMHYQMSVTLKYEIKKLIYVHLVIWLLLVAKMSVGHLRLLSHDQVAM      1 - 70
PYQWEYPYLLSILPSLLGLLSFPRNNISYLVLSMISMGLFSIAPLIYGSMEMFPAAQQLYRHGKAYRFLF     71 - 140
GFSAVSIMYLVLVLAVQVHAWQLYYSKKLLDSWFTSTQEKKHK                               141 - 183
//

Text Mined References (12)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25129145 2014 Jagunal homolog 1 is a critical regulator of neutrophil function in fungal host defense.
25129144 2014 JAGN1 deficiency causes aberrant myeloid cell homeostasis and congenital neutropenia.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
17389229 2007 Jagunal is required for reorganizing the endoplasmic reticulum during Drosophila oogenesis.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...