Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.81
PubTator Score 8.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.200 1.1e-03

Gene RIF (2)

AA Sequence

MASRAGPRAAGTDGSDFQHRERVAMHYQMSVTLKYEIKKLIYVHLVIWLLLVAKMSVGHLRLLSHDQVAM      1 - 70
PYQWEYPYLLSILPSLLGLLSFPRNNISYLVLSMISMGLFSIAPLIYGSMEMFPAAQQLYRHGKAYRFLF     71 - 140
GFSAVSIMYLVLVLAVQVHAWQLYYSKKLLDSWFTSTQEKKHK                               141 - 183
//

Text Mined References (12)

PMID Year Title