Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Prostatic Neoplasms 495 0.0 0.0
Disease Target Count P-value
Breast cancer 3578 1.2e-12
tuberculosis and treatment for 6 months 409 1.5e-05
astrocytic glioma 2597 6.5e-03
ependymoma 4679 1.1e-02
oligodendroglioma 2850 1.7e-02
osteosarcoma 7950 3.2e-02

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma -1.100 6.5e-03
Breast cancer 1.100 1.2e-12
ependymoma -1.100 1.1e-02
oligodendroglioma 1.100 1.7e-02
osteosarcoma 1.001 3.2e-02
tuberculosis and treatment for 6 months -1.200 1.5e-05

Synonym

Accession Q8N5M4 Q8WYY7 TPR repeat protein 9C
Symbols

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 Compartment GO Term (2)

Gene RIF (1)

AA Sequence

MEKRLQEAQLYKEEGNQRYREGKYRDAVSRYHRALLQLRGLDPSLPSPLPNLGPQGPALTPEQENILHTT      1 - 70
QTDCYNNLAACLLQMEPVNYERVREYSQKVLERQPDNAKALYRAGVAFFHLQDYDQARHYLLAAVNRQPK     71 - 140
DANVRRYLQLTQSELSSYHRKEKQLYLGMFG                                           141 - 171
//

Text Mined References (8)

PMID Year Title