Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Prostatic Neoplasms 471
Disease Target Count P-value
Breast cancer 3099 1.20204501628612E-12
tuberculosis and treatment for 6 months 686 1.53222029328497E-5
astrocytic glioma 2241 0.00653268617227328
ependymoma 2514 0.011272372153816
oligodendroglioma 2849 0.0167851732378614
osteosarcoma 7933 0.0318026715663427

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma -1.100 0.007
ependymoma -1.100 0.011
oligodendroglioma 1.100 0.017
osteosarcoma 1.001 0.032
tuberculosis and treatment for 6 months -1.200 0.000
Breast cancer 1.100 0.000

Synonym

Accession Q8N5M4 Q8WYY7 TPR repeat protein 9C
Symbols

Gene

PANTHER Protein Class (1)

  Ortholog (9)

Gene RIF (1)

PMID Text
19165527 Using shotgun mass spectrometry, we found this protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.

AA Sequence

MEKRLQEAQLYKEEGNQRYREGKYRDAVSRYHRALLQLRGLDPSLPSPLPNLGPQGPALTPEQENILHTT      1 - 70
QTDCYNNLAACLLQMEPVNYERVREYSQKVLERQPDNAKALYRAGVAFFHLQDYDQARHYLLAAVNRQPK     71 - 140
DANVRRYLQLTQSELSSYHRKEKQLYLGMFG                                           141 - 171
//

Text Mined References (8)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25416956 2014 A proteome-scale map of the human interactome network.
21269460 2011 Initial characterization of the human central proteome.
19165527 2009 Prefrontal cortex shotgun proteome analysis reveals altered calcium homeostasis and immune system imbalance in schizophrenia.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.