Property Summary

NCBI Gene PubMed Count 18
PubMed Score 13.84
PubTator Score 7.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
psoriasis 6694 4.1e-04
osteosarcoma 7950 1.4e-03
Disease Target Count Z-score Confidence
3-methylglutaconic aciduria 29 5.353 2.7

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.423 1.4e-03
psoriasis -1.400 4.1e-04

Synonym

Accession Q8N5M1 A6NDE5 A8K2J2 Q6XYC7
Symbols ATP12
ATP12p
LP3663
MC5DN1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GWAS Trait (1)

Protein-protein Interaction (6)

Gene RIF (4)

AA Sequence

MWRSCLRLRDGGRRLLNRPAGGPSASMSPGPTIPSPARAYAPPTERKRFYQNVSITQGEGGFEINLDHRK      1 - 70
LKTPQAKLFTVPSEALAIAVATEWDSQQDTIKYYTMHLTTLCNTSLDNPTQRNKDQLIRAAVKFLDTDTI     71 - 140
CYRVEEPETLVELQRNEWDPIIEWAEKRYGVEISSSTSIMGPSIPAKTREVLVSHLASYNTWALQGIEFV    141 - 210
AAQLKSMVLTLGLIDLRLTVEQAVLLSRLEEEYQIQKWGNIEWAHDYELQELRARTAAGTLFIHLCSEST    211 - 280
TVKHKLLKE                                                                 281 - 289
//

Text Mined References (24)

PMID Year Title