Property Summary

NCBI Gene PubMed Count 29
PubMed Score 36.25
PubTator Score 22.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
pituitary cancer 1972 4.80488417691738E-7
osteosarcoma 7933 2.79060485876459E-6
ovarian cancer 8492 6.89729533355114E-5
glioblastoma 5572 1.06851121226524E-4
astrocytic glioma 2241 0.00843970367961808
ependymoma 2514 0.0197026150886258
oligodendroglioma 2849 0.0223009460226585
Disease Target Count Z-score Confidence
diabetes mellitus 1663 0.0 4.0
Disease Target Count
Wolfram syndrome 11
Wolfram syndrome 2 1

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma -1.600 0.008
ependymoma -1.500 0.020
oligodendroglioma -1.200 0.022
osteosarcoma -2.904 0.000
glioblastoma -1.300 0.000
ovarian cancer 2.400 0.000
pituitary cancer 1.100 0.000

Synonym

Accession Q8N5K1 Q7Z3D5
Symbols ERIS
WFS2
ZCD2
NAF-1
Miner1

Gene

PDB

3FNV   4OO7   4OOA  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA Inparanoid
Xenopus OMA EggNOG
Fruitfly OMA EggNOG Inparanoid

Pathway (1)

Gene RIF (13)

PMID Text
26621032 NAF-1 is a major player in the metabolic regulation of breast cancer cells.
26565812 High CISD2 expression was significantly associated with gastric cancer.
26154755 The findings suggested that CISD2 haplotype-tagging single nucleotide polymorphisms are not associated with Alzheimer's disease risk.
25371195 A novel CISD2 mutation is associated with wolfram syndrome 2.
25134919 Studied the expression pattern and clinicopathological significance of CISD2 in patients with early-stage cervical cancer.
24706857 provides the first structural information, to our knowledge, for future targeting of the NAF-1-Bcl-2 complex in the regulation of apoptosis/autophagy in cancer biology
23959881 Data show that the protein levels of NAF-1 (CISD2) and mNT (CISD1) are elevated in human epithelial breast cancer cells.
23717386 NAF-1 as a previously unidentified cell target of anti-diabetes thiazolidinedione drugs.
20649540 CISD2 has a role in lifespan control and disease [review]
20010695 NAF-1 is a BCL-2-associated co-factor that targets BCL-2 for antagonism of the autophagy pathway at the endoplasmic reticulum.
More...

AA Sequence

MVLESVARIVKVQLPAYLKRLPVPESITGFARLTVSEWLRLLPFLGVLALLGYLAVRPFLPKKKQQKDSL      1 - 70
INLKIQKENPKVVNEINIEDLCLTKAAYCRCWRSKTFPACDGSHNKHNELTGDNVGPLILKKKEV          71 - 135
//

Text Mined References (34)

PMID Year Title
26621032 2016 Activation of apoptosis in NAF-1-deficient human epithelial breast cancer cells.
26565812 2016 Overexpressed CISD2 has prognostic value in human gastric cancer and promotes gastric cancer cell proliferation and tumorigenesis via AKT signaling pathway.
26154755 2015 Sequence variants of the aging gene CISD2 and the risk for Alzheimer's disease.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25371195 2015 Wolfram syndrome 2: a novel CISD2 mutation identified in Italian siblings.
25134919 2014 CISD2 expression is a novel marker correlating with pelvic lymph node metastasis and prognosis in patients with early-stage cervical cancer.
24706857 2014 Integrated strategy reveals the protein interface between cancer targets Bcl-2 and NAF-1.
24159190 2014 Genome-wide association study on dimethylarginines reveals novel AGXT2 variants associated with heart rate variability but not with overall mortality.
23959881 2013 NAF-1 and mitoNEET are central to human breast cancer proliferation by maintaining mitochondrial homeostasis and promoting tumor growth.
23717386 2013 Nutrient-deprivation autophagy factor-1 (NAF-1): biochemical properties of a novel cellular target for anti-diabetic drugs.
More...