Property Summary

NCBI Gene PubMed Count 35
PubMed Score 43.29
PubTator Score 22.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Diabetes Mellitus, Type 2 142 0.0 0.0
WOLFRAM SYNDROME 2 1 0.0 0.0
Disease Target Count P-value
pituitary cancer 1972 4.8e-07
osteosarcoma 7950 2.8e-06
glioblastoma 5792 1.1e-04
ovarian cancer 8519 2.2e-04
astrocytic glioma 2597 8.4e-03
ependymoma 4679 2.0e-02
oligodendroglioma 2850 2.2e-02
Disease Target Count Z-score Confidence
diabetes mellitus 1728 0.0 4.0
Disease Target Count
Wolfram syndrome 12

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma -1.600 8.4e-03
ependymoma -1.500 2.0e-02
glioblastoma -1.300 1.1e-04
oligodendroglioma -1.200 2.2e-02
osteosarcoma -2.904 2.8e-06
ovarian cancer -1.200 2.2e-04
pituitary cancer 1.100 4.8e-07

 OMIM Phenotype (1)

Protein-protein Interaction (1)

Gene RIF (19)

AA Sequence

MVLESVARIVKVQLPAYLKRLPVPESITGFARLTVSEWLRLLPFLGVLALLGYLAVRPFLPKKKQQKDSL      1 - 70
INLKIQKENPKVVNEINIEDLCLTKAAYCRCWRSKTFPACDGSHNKHNELTGDNVGPLILKKKEV          71 - 135
//

Text Mined References (40)

PMID Year Title