Property Summary

NCBI Gene PubMed Count 5
PubMed Score 29.92
PubTator Score 16.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Gene RIF (1)

AA Sequence

MTCVEQDKLGQAFEDAFEVLRQHSTGDLQYSPDYRNYLALINHRPHVKGNSSCYGVLPTEEPVYNWRTVI      1 - 70
NSAADFYFEGNIHQSLQNITENQLVQPTLLQQKGGKGRKKLRLFEYLHESLYNPEMASCIQWVDKTKGIF     71 - 140
QFVSKNKEKLAELWGKRKGNRKTMTYQKMARALRNYGRSGEITKIRRKLTYQFSEAILQRLSPSYFLGKE    141 - 210
IFYSQCVQPDQEYLSLNNWNANYNYTYANYHELNHHDC                                    211 - 248
//

Text Mined References (5)

PMID Year Title