Property Summary

NCBI Gene PubMed Count 5
Grant Count 8
Funding $344,839.9
PubMed Score 28.41
PubTator Score 16.15

Knowledge Summary

Patent

No data available

Gene RIF (1)

PMID Text
16647686 A protein interaction between SPI-C and STAT6 is the basis for a novel mechanism for regulation of IL4 induced gene expression.

AA Sequence

MTCVEQDKLGQAFEDAFEVLRQHSTGDLQYSPDYRNYLALINHRPHVKGNSSCYGVLPTEEPVYNWRTVI      1 - 70
NSAADFYFEGNIHQSLQNITENQLVQPTLLQQKGGKGRKKLRLFEYLHESLYNPEMASCIQWVDKTKGIF     71 - 140
QFVSKNKEKLAELWGKRKGNRKTMTYQKMARALRNYGRSGEITKIRRKLTYQFSEAILQRLSPSYFLGKE    141 - 210
IFYSQCVQPDQEYLSLNNWNANYNYTYANYHELNHHDC                                    211 - 248
//

Text Mined References (5)

PMID Year Title
24709693 2014 Genome-wide data reveal novel genes for methotrexate response in a large cohort of juvenile idiopathic arthritis cases.
16647686 2006 SPI-C and STAT6 can cooperate to stimulate IgE germline transcription.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12459275 2002 Genomic structure of mouse SPI-C and genomic structure and expression pattern of human SPI-C.