Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.42
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (5)

Disease log2 FC p
Astrocytoma, Pilocytic 1.400 5.7e-08
esophageal adenocarcinoma -1.100 1.8e-02
malignant mesothelioma -1.500 2.0e-06
pancreatic cancer 1.100 9.9e-04
pancreatic carcinoma 1.100 9.9e-04

Gene RIF (1)

AA Sequence

MEYHQPEDPAPGKAGTAEAVIPENHEVLAGPDEHPQDTDARDADGEAREREPADQALLPSQCGDNLESPL      1 - 70
PEASSAPPGPTLGTLPEVETIRACSMPQELPQSPRTRQPEPDFYCVKWIPWKGEQTPIITQSTNGPCPLL     71 - 140
AIMNILFLQWKVKLPPQKEVITSDELMAHLGNCLLSIKPQEKSEGLQLNFQQNVDDAMTVLPKLATGLDV    141 - 210
NVRFTGVSDFEYTPECSVFDLLGIPLYHGWLVDPQSPEAVRAVGKLSYNQLVERIITCKHSSDTNLVTEG    211 - 280
LIAEQFLETTAAQLTYHGLCELTAAAKEGELSVFFRNNHFSTMTKHKSHLYLLVTDQGFLQEEQVVWESL    281 - 350
HNVDGDSCFCDSDFHLSHSLGKGPGAEGGSGSPETQLQVDQDYLIALSLQQQQPRGPLGLTDLELAQQLQ    351 - 420
QEEYQQQQAAQPVRMRTRVLSLQGRGATSGRPAGERRQRPKHESDCILL                         421 - 469
//

Text Mined References (17)

PMID Year Title