Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MEVHGKPKASPSCSSPTRDSSGVPVSKELLTAGSDGRGGIWDRLLINSQPKSRKTSTLQTVRIERSPLLD      1 - 70
QVQTFLPQMARANEKLRKEMAAAPPGRFNIENIDGPHSKVIQMDVALFEMNQSDSKEVDSSEESSQDSSE     71 - 140
NSSESEDEDDSIPSEVTIDNIKLPNSEGGKGKIEVLDSPASKKKK                             141 - 185
//

Text Mined References (13)

PMID Year Title