Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.49
PubTator Score 2.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Synonym

Accession Q8N5I4 Q6UWC7 Q8WUS4 Q96GR8 Q9NTF6
Symbols DHRSY
DHRS5X
DHRS5Y
DHRSXY
SDR7C6
CXorf11
SDR46C1

Gene

PANTHER Protein Class (2)

 GO Function (1)

 Compartment GO Term (1)

Gene RIF (1)

PMID Text
25076851 these results demonstrate that DHRSX is a novel non-classical secretory protein involved in the positive regulation of starvation induced autophagy and provide a new avenue for research on this protein family and autophagy regulation

AA Sequence

MSPLSAARAALRVYAVGAAVILAQLLRRCRGGFLEPVFPPRPDRVAIVTGGTDGIGYSTAKHLARLGMHV      1 - 70
IIAGNNDSKAKQVVSKIKEETLNDKVEFLYCDLASMTSIRQFVQKFKMKKIPLHVLINNAGVMMVPQRKT     71 - 140
RDGFEEHFGLNYLGHFLLTNLLLDTLKESGSPGHSARVVTVSSATHYVAELNMDDLQSSACYSPHAAYAQ    141 - 210
SKLALVLFTYHLQRLLAAEGSHVTANVVDPGVVNTDVYKHVFWATRLAKKLLGWLLFKTPDEGAWTSIYA    211 - 280
AVTPELEGVGGHYLYNEKETKSLHVTYNQKLQQQLWSKSCEMTGVLDVTL                        281 - 330
//

Text Mined References (10)

PMID Year Title
25076851 2014 DHRSX, a novel non-classical secretory protein associated with starvation induced autophagy.
19027726 2009 The SDR (short-chain dehydrogenase/reductase and related enzymes) nomenclature initiative.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16341674 2005 Transcriptome analysis of human gastric cancer.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11731500 2001 Differential divergence of three human pseudoautosomal genes and their mouse homologs: implications for sex chromosome evolution.