Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.49
PubTator Score 2.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.500 1.9e-07
ependymoma 1.100 1.1e-10
glioblastoma 1.200 3.3e-08
group 3 medulloblastoma 1.100 1.7e-03
ovarian cancer 1.100 2.8e-04
pancreatic ductal adenocarcinoma liver m... -1.580 1.9e-03
pediatric high grade glioma 1.300 9.3e-08
primitive neuroectodermal tumor 1.100 5.4e-05

Synonym

Accession Q8N5I4 Q6UWC7 Q8WUS4 Q96GR8 Q9NTF6
Symbols DHRSY
DHRS5X
DHRS5Y
DHRSXY
SDR7C6
CXorf11
SDR46C1

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG Inparanoid

Gene RIF (1)

AA Sequence

MSPLSAARAALRVYAVGAAVILAQLLRRCRGGFLEPVFPPRPDRVAIVTGGTDGIGYSTAKHLARLGMHV      1 - 70
IIAGNNDSKAKQVVSKIKEETLNDKVEFLYCDLASMTSIRQFVQKFKMKKIPLHVLINNAGVMMVPQRKT     71 - 140
RDGFEEHFGLNYLGHFLLTNLLLDTLKESGSPGHSARVVTVSSATHYVAELNMDDLQSSACYSPHAAYAQ    141 - 210
SKLALVLFTYHLQRLLAAEGSHVTANVVDPGVVNTDVYKHVFWATRLAKKLLGWLLFKTPDEGAWTSIYA    211 - 280
AVTPELEGVGGHYLYNEKETKSLHVTYNQKLQQQLWSKSCEMTGVLDVTL                        281 - 330
//

Text Mined References (10)

PMID Year Title