Property Summary

NCBI Gene PubMed Count 14
PubMed Score 6.94
PubTator Score 9.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (6)

PMID Text
20237900 The haploinsufficiency of KCNRG might be relevant to the progression of chronic lymphocytic leukemia (CLL)and multiple myeloma(MM) at least in a subset of patients.
19968958 KCNRG is an ER-associated protein, which is proposed to regulate Kv1 family channel proteins by retaining a fraction of channels in endomembranes.
19251657 Autoantibodies to KCNRG were present in 7 of the 8 patients with respiratory symptoms in autoimmune polyendocrine syndrome type 1
16819283 Results suggest that genetic alterations and the expression of KCNRG might play an important role in the development and/or progression of a subset of hepatocellular carcinoma.
12650944 KCNRG suppresses K+ channel activity in human prostate cell line LNCaP.
12650944 the primary characterization of a new gene KCNRG mapped at chromosome band 13q14.3; is a candidate for a B-cell chronic lymphocytic leukemia and prostate cancer tumor suppressor gene

AA Sequence

MSSQELVTLNVGGKIFTTRFSTIKQFPASRLARMLDGRDQEFKMVGGQIFVDRDGDLFSFILDFLRTHQL      1 - 70
LLPTEFSDYLRLQREALFYELRSLVDLLNPYLLQPRPALVEVHFLSRNTQAFFRVFGSCSKTIEMLTGRI     71 - 140
TVFTEQPSAPTWNGNFFPPQMTLLPLPPQRPSYHDLVFQCGSDSTTDNQTGVRYVSIKPDNRKLANGTNV    141 - 210
LGLLIDTLLKEGFHLVSTRTVSSEDKTECYSFERIKSPEVLITNETPKPETIIIPEQSQIKK            211 - 272
//

Text Mined References (15)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
20237900 2010 Pro-apoptotic and antiproliferative activity of human KCNRG, a putative tumor suppressor in 13q14 region.
19968958 2010 Potassium channel regulator KCNRG regulates surface expression of Shaker-type potassium channels.
19447967 2009 Shifted Transversal Design smart-pooling for high coverage interactome mapping.
19251657 2009 Pulmonary autoimmunity as a feature of autoimmune polyendocrine syndrome type 1 and identification of KCNRG as a bronchial autoantigen.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16819283 2006 Genetic and expression analysis of the KCNRG gene in hepatocellular carcinomas.
16499869 2006 Human RFP2 gene promoter: unique structure and unusual strength.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15188451 2004 DLEU2 encodes an antisense RNA for the putative bicistronic RFP2/LEU5 gene in humans and mouse.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12650944 2003 A new human gene KCNRG encoding potassium channel regulating protein is a cancer suppressor gene candidate located in 13q14.3.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.