Property Summary

NCBI Gene PubMed Count 12
PubMed Score 4.40
PubTator Score 2.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
tuberculosis 2010 3.3e-07
osteosarcoma 7950 7.3e-07
ovarian cancer 8520 1.1e-06
Atopic dermatitis 952 2.1e-04
Disease Target Count Z-score Confidence
Cataract 7 32 4.453 2.2
Arts syndrome 26 3.95 2.0

Expression

  Differential Expression (4)

Disease log2 FC p
Atopic dermatitis 1.200 2.1e-04
osteosarcoma -2.076 7.3e-07
ovarian cancer 1.200 1.1e-06
tuberculosis 1.300 3.3e-07

Synonym

Accession Q8N5I2
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MGRVQLFEISLSHGRVVYSPGEPLAGTVRVRLGAPLPFRAIRVTCIGSCGVSNKANDTAWVVEEGYFNSS      1 - 70
LSLADKGSLPAGEHSFPFQFLLPATAPTSFEGPFGKIVHQVRAAIHTPRFSKDHKCSLVFYILSPLNLNS     71 - 140
IPDIEQPNVASATKKFSYKLVKTGSVVLTASTDLRGYVVGQALQLHADVENQSGKDTSPVVASLLQKVSY    141 - 210
KAKRWIHDVRTIAEVEGAGVKAWRRAQWHEQILVPALPQSALPGCSLIHIDYYLQVSLKAPEATVTLPVF    211 - 280
IGNIAVNHAPVSPRPGLGLPPGAPPLVVPSAPPQEEAEAEAAAGGPHFLDPVFLSTKSHSQRQPLLATLS    281 - 350
SVPGAPEPCPQDGSPASHPLHPPLCISTGATVPYFAEGSGGPVPTTSTLILPPEYSSWGYPYEAPPSYEQ    351 - 420
SCGGVEPSLTPES                                                             421 - 433
//

Text Mined References (13)

PMID Year Title