Property Summary

NCBI Gene PubMed Count 10
PubMed Score 4.10
PubTator Score 2.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -2.076 0.000
Atopic dermatitis 1.200 0.000
tuberculosis 1.300 0.000
ovarian cancer 1.200 0.000

Synonym

Accession Q8N5I2
Symbols

Gene

Gene RIF (1)

PMID Text
21191027 The authors show that WWP1 changes the ubiquitination status of ARRDC1, suggesting that the arrestins may provide a platform for ubiquitination in PPXY-dependent budding.

AA Sequence

MGRVQLFEISLSHGRVVYSPGEPLAGTVRVRLGAPLPFRAIRVTCIGSCGVSNKANDTAWVVEEGYFNSS      1 - 70
LSLADKGSLPAGEHSFPFQFLLPATAPTSFEGPFGKIVHQVRAAIHTPRFSKDHKCSLVFYILSPLNLNS     71 - 140
IPDIEQPNVASATKKFSYKLVKTGSVVLTASTDLRGYVVGQALQLHADVENQSGKDTSPVVASLLQKVSY    141 - 210
KAKRWIHDVRTIAEVEGAGVKAWRRAQWHEQILVPALPQSALPGCSLIHIDYYLQVSLKAPEATVTLPVF    211 - 280
IGNIAVNHAPVSPRPGLGLPPGAPPLVVPSAPPQEEAEAEAAAGGPHFLDPVFLSTKSHSQRQPLLATLS    281 - 350
SVPGAPEPCPQDGSPASHPLHPPLCISTGATVPYFAEGSGGPVPTTSTLILPPEYSSWGYPYEAPPSYEQ    351 - 420
SCGGVEPSLTPES                                                             421 - 433
//

Text Mined References (11)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23886940 2013 ?-arrestin 1 (ARRDC1) and ?-arrestins cooperate to mediate Notch degradation in mammals.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23236378 2012 Mammalian ? arrestins link activated seven transmembrane receptors to Nedd4 family e3 ubiquitin ligases and interact with ? arrestins.
21191027 2011 Multiple interactions between the ESCRT machinery and arrestin-related proteins: implications for PPXY-dependent budding.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...