Property Summary

NCBI Gene PubMed Count 19
PubMed Score 127.20
PubTator Score 176.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma -1.300 2.1e-06
Astrocytoma, Pilocytic -1.100 3.5e-06
cystic fibrosis -1.216 3.6e-04
ependymoma -1.200 2.0e-10
interstitial cystitis 1.100 4.4e-02
lung carcinoma -1.100 7.2e-13
non-small cell lung cancer -2.098 9.4e-23
osteosarcoma -1.725 2.3e-04

Gene RIF (5)

AA Sequence

MTEGTKKTSKKFKFFKFKGFGSLSNLPRSFTLRRSSASISRQSHLEPDTFEATQDDMVTVPKSPPAYARS      1 - 70
SDMYSHMGTMPRPSIKKAQNSQAARQAQEAGPKPNLVPGGVPDPPGLEAAKEVMVKATGPLEDTPAMEPN     71 - 140
PSAVEVDPIRKPEVPTGDVEEERPPRDVHSERAAGEPEAGSDYVKFSKEKYILDSSPEKLHKELEEELKL    141 - 210
SSTDLRSHAWYHGRIPREVSETLVQRNGDFLIRDSLTSLGDYVLTCRWRNQALHFKINKVVVKAGESYTH    211 - 280
IQYLFEQESFDHVPALVRYHVGSRKAVSEQSGAIIYCPVNRTFPLRYLEASYGLGQGSSKPASPVSPSGP    281 - 350
KGSHMKRRSVTMTDGLTADKVTRSDGCPTSTSLPRPRDSIRSCALSMDQIPDLHSPMSPISESPSSPAYS    351 - 420
TVTRVHAAPAAPSATALPASPVARRSSEPQLCPGSAPKTHGESDKGPHTSPSHTLGKASPSPSLSSYSDP    421 - 490
DSGHYCQLQPPVRGSREWAATETSSQQARSYGERLKELSENGAPEGDWGKTFTVPIVEVTSSFNPATFQS    491 - 560
LLIPRDNRPLEVGLLRKVKELLAEVDARTLARHVTKVDCLVARILGVTKEMQTLMGVRWGMELLTLPHGR    561 - 630
QLRLDLLERFHTMSIMLAVDILGCTGSAEERAALLHKTIQLAAELRGTMGNMFSFAAVMGALDMAQISRL    631 - 700
EQTWVTLRQRHTEGAILYEKKLKPFLKSLNEGKEGPPLSNTTFPHVLPLITLLECDSAPPEGPEPWGSTE    701 - 770
HGVEVVLAHLEAARTVAHHGGLYHTNAEVKLQGFQARPELLEVFSTEFQMRLLWGSQGASSSQARRYEKF    771 - 840
DKVLTALSHKLEPAVRSSEL                                                      841 - 860
//

Text Mined References (21)

PMID Year Title