Property Summary

NCBI Gene PubMed Count 19
Grant Count 32
R01 Count 24
Funding $3,583,936.83
PubMed Score 125.32
PubTator Score 176.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma -1.725 0.000
posterior fossa group B ependymoma -1.500 0.000
cystic fibrosis -1.511 0.000
non-small cell lung cancer -2.098 0.000
interstitial cystitis 1.700 0.000
adult high grade glioma -1.300 0.000
pilocytic astrocytoma -1.100 0.000
lung carcinoma -1.100 0.000

Gene RIF (5)

PMID Text
22081014 The structure of the NSP3-p130Cas complex reveals that this closed conformation is instrumental for interaction of NSP proteins with a focal adhesion-targeting domain present in Cas proteins.
20583170 Observational study of gene-disease association. (HuGE Navigator)
17427198 NSP3 overexpression did not induce anti-estrogen resistance in breast tumor cell lines.
17270363 SH2D3C (SHEP1) is less highly expressed than BCAR3 and NSP1 in breast cancer cells, and the expression patterns suggest differential roles for the three genes during breast cancer progression.
12486027 This protein positively regulates T cell receptor-mediated interleukin-2 production by Jurkat cells.

AA Sequence

MTEGTKKTSKKFKFFKFKGFGSLSNLPRSFTLRRSSASISRQSHLEPDTFEATQDDMVTVPKSPPAYARS      1 - 70
SDMYSHMGTMPRPSIKKAQNSQAARQAQEAGPKPNLVPGGVPDPPGLEAAKEVMVKATGPLEDTPAMEPN     71 - 140
PSAVEVDPIRKPEVPTGDVEEERPPRDVHSERAAGEPEAGSDYVKFSKEKYILDSSPEKLHKELEEELKL    141 - 210
SSTDLRSHAWYHGRIPREVSETLVQRNGDFLIRDSLTSLGDYVLTCRWRNQALHFKINKVVVKAGESYTH    211 - 280
IQYLFEQESFDHVPALVRYHVGSRKAVSEQSGAIIYCPVNRTFPLRYLEASYGLGQGSSKPASPVSPSGP    281 - 350
KGSHMKRRSVTMTDGLTADKVTRSDGCPTSTSLPRPRDSIRSCALSMDQIPDLHSPMSPISESPSSPAYS    351 - 420
TVTRVHAAPAAPSATALPASPVARRSSEPQLCPGSAPKTHGESDKGPHTSPSHTLGKASPSPSLSSYSDP    421 - 490
DSGHYCQLQPPVRGSREWAATETSSQQARSYGERLKELSENGAPEGDWGKTFTVPIVEVTSSFNPATFQS    491 - 560
LLIPRDNRPLEVGLLRKVKELLAEVDARTLARHVTKVDCLVARILGVTKEMQTLMGVRWGMELLTLPHGR    561 - 630
QLRLDLLERFHTMSIMLAVDILGCTGSAEERAALLHKTIQLAAELRGTMGNMFSFAAVMGALDMAQISRL    631 - 700
EQTWVTLRQRHTEGAILYEKKLKPFLKSLNEGKEGPPLSNTTFPHVLPLITLLECDSAPPEGPEPWGSTE    701 - 770
HGVEVVLAHLEAARTVAHHGGLYHTNAEVKLQGFQARPELLEVFSTEFQMRLLWGSQGASSSQARRYEKF    771 - 840
DKVLTALSHKLEPAVRSSEL                                                      841 - 860
//

Text Mined References (21)

PMID Year Title
24728074 2014 Enhanced prediction of Src homology 2 (SH2) domain binding potentials using a fluorescence polarization-derived c-Met, c-Kit, ErbB, and androgen receptor interactome.
23568457 2013 Genetic variants associated with disordered eating.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22081014 2011 NSP-Cas protein structures reveal a promiscuous interaction module in cell signaling.
20583170 2010 Follow-up association studies of chromosome region 9q and nonsyndromic cleft lip/palate.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17562024 2007 Large-scale identification of human genes implicated in epidermal barrier function.
17427198 2007 AND-34/BCAR3 differs from other NSP homologs in induction of anti-estrogen resistance, cyclin D1 promoter activation and altered breast cancer cell morphology.
17270363 2007 Splice variants and expression patterns of SHEP1, BCAR3 and NSP1, a gene family involved in integrin and receptor tyrosine kinase signaling.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...