Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
acute myeloid leukemia -1.100 2.2e-02
hereditary spastic paraplegia -1.034 5.1e-03
ovarian cancer -2.000 5.3e-07
pancreatic ductal adenocarcinoma liver m... -1.605 2.0e-02

Gene RIF (2)

AA Sequence

MSRNLRTALIFGGFISLIGAAFYPIYFRPLMRLEEYKKEQAINRAGIVQEDVQPPGLKVWSDPFGRK         1 - 67
//

Text Mined References (7)

PMID Year Title