Property Summary

NCBI Gene PubMed Count 31
PubMed Score 24.57
PubTator Score 13.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
acute myeloid leukemia 1.200 2.1e-02
atypical teratoid / rhabdoid tumor 1.500 1.0e-04
glioblastoma 1.500 1.2e-03
group 4 medulloblastoma 1.300 1.2e-03
medulloblastoma, large-cell 1.900 7.9e-05
osteosarcoma -1.719 7.8e-04
ovarian cancer -2.000 9.1e-07
pancreatic ductal adenocarcinoma liver m... -1.183 2.9e-02
spina bifida -1.895 3.6e-02
tuberculosis and treatment for 6 months 1.200 2.3e-02

 GO Function (1)

Protein-protein Interaction (2)

Gene RIF (23)

AA Sequence

MAQSSPQLDIQVLHDLRQRFPEIPEGVVSQCMLQNNNNLEACCRALSQESSKYLYMEYHSPDDNRMNRNR      1 - 70
LLHINLGIHSPSSYHPGDGAQLNGGRTLVHSSSDGHIDPQHAAGKQLICLVQEPHSAPAVVAATPNYNPF     71 - 140
FMNEQNRSAATPPSQPPQQPSSMQTGMNPSAMQGPSPPPPPPSYMHIPRYSTNPITVTVSQNLPSGQTVP    141 - 210
RALQILPQIPSNLYGSPGSIYIRQTSQSSSGRQTPQSTPWQSSPQGPVPHYSQRPLPVYPHQQNYQPSQY    211 - 280
SPKQQQIPQSAYHSPPPSQCPSPFSSPQHQVQPSQLGHIFMPPSPSTTPPHPYQQGPPSYQKQGSHSVAY    281 - 350
LPYTASSLSKGSMKKIEITVEPSQRPGTAINRSPSPISNQPSPWNQHSLYTATTPPSSSPSRGISSQPKP    351 - 420
PFSVNPVYITYTQPTGPSCTPSPSPRVIPNPTTVFKITVGRATTENLLNLVDQEERSAAPEPIQPISVIP    421 - 490
GSGGEKGSHKYQRSSSSGSDDYAYTQALLLHQRARMERLAKQLKLEKEELERLKSEVNGMEHDLMQRRLR    491 - 560
RVSCTTAIPTPEEMTRLRSMNRQLQINVDCTLKEVDLLQSRGNFDPKAMNNFYDNIEPGPVVPPKPSKKD    561 - 630
SSDPCTIERKARRISVTSKVQADIHDTQAAAADEHRTGSTQSPRTQPRDEDYEGAPWNCDSCTFLNHPAL    631 - 700
NRCEQCEMPRYT                                                              701 - 712
//

Text Mined References (38)

PMID Year Title