Property Summary

NCBI Gene PubMed Count 27
Grant Count 82
R01 Count 55
Funding $11,953,900.29
PubMed Score 21.99
PubTator Score 13.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Synonym

Accession Q8N5C8 A6NDD9 Q6VQR0
Symbols NAP1
MAP3K7IP3

Gene

PANTHER Protein Class (1)

 GO Function (1)

Gene RIF (19)

PMID Text
26676784 Upregulation of miR-532-5p and subsequent suppression of the SESTD1 and TAB3 genes represent an antiviral response aimed at limiting West Nile virus infection.
26555189 miR-30a in MSCs may participate in the immune dysregulation of the maternal-fetal interface during PE
24912525 The ability of HIV-1 Vpr to activate NF-kappaB or activator protein 1-dependent luciferase expression requires TAK1, TRAF6, or TAB3 in cells
24565101 miR-26b suppresses NF-kappaB signaling and sensitizes hepatocellular carcinoma cells to doxorubicin-induced apoptosis by inhibiting the expression of TAK1 and TAB3.
24434549 conclude that TRIM38 negatively regulates TNFalpha- and IL-1beta-induced signaling by mediating lysosome-dependent degradation of TAB2/3, two critical components in TNFalpha- and IL-1beta-induced signaling pathways
23286385 Studies show that three proteins expressed in HEK-293T cells (NAP1, TANK and TBKBP1) interact with TBK1.
22660635 MiR-23b suppresses IL-17-, tumor necrosis factor alpha (TNF-alpha)- or IL-1beta-induced NF-kappaB activation and inflammatory cytokine expression by targeting TAB2, TAB3 and IKK-alpha.
22158122 human TAB2 and TAB3, ubiquitin-chain sensory proteins involved in NF-kappaB signalling, are directly inactivated by enteropathogenic Escherichia coli NleE, a conserved bacterial type-III-secreted effector responsible for blocking host NF-kappaB signalling
22081109 These results point to the existence of an autophagy-stimulatory 'switch' whereby TAB2 and TAB3 abandon inhibitory interactions with Beclin 1 to engage in a stimulatory liaison with TAK1.
21866272 The ability of HIV-1 Vpr to activate NF-kappaB or activator protein 1-dependent luciferase expression requires TAK1, TRAF6, or TAB3 in cells
More...

AA Sequence

MAQSSPQLDIQVLHDLRQRFPEIPEGVVSQCMLQNNNNLEACCRALSQESSKYLYMEYHSPDDNRMNRNR      1 - 70
LLHINLGIHSPSSYHPGDGAQLNGGRTLVHSSSDGHIDPQHAAGKQLICLVQEPHSAPAVVAATPNYNPF     71 - 140
FMNEQNRSAATPPSQPPQQPSSMQTGMNPSAMQGPSPPPPPPSYMHIPRYSTNPITVTVSQNLPSGQTVP    141 - 210
RALQILPQIPSNLYGSPGSIYIRQTSQSSSGRQTPQSTPWQSSPQGPVPHYSQRPLPVYPHQQNYQPSQY    211 - 280
SPKQQQIPQSAYHSPPPSQCPSPFSSPQHQVQPSQLGHIFMPPSPSTTPPHPYQQGPPSYQKQGSHSVAY    281 - 350
LPYTASSLSKGSMKKIEITVEPSQRPGTAINRSPSPISNQPSPWNQHSLYTATTPPSSSPSRGISSQPKP    351 - 420
PFSVNPVYITYTQPTGPSCTPSPSPRVIPNPTTVFKITVGRATTENLLNLVDQEERSAAPEPIQPISVIP    421 - 490
GSGGEKGSHKYQRSSSSGSDDYAYTQALLLHQRARMERLAKQLKLEKEELERLKSEVNGMEHDLMQRRLR    491 - 560
RVSCTTAIPTPEEMTRLRSMNRQLQINVDCTLKEVDLLQSRGNFDPKAMNNFYDNIEPGPVVPPKPSKKD    561 - 630
SSDPCTIERKARRISVTSKVQADIHDTQAAAADEHRTGSTQSPRTQPRDEDYEGAPWNCDSCTFLNHPAL    631 - 700
NRCEQCEMPRYT                                                              701 - 712
//

Text Mined References (34)

PMID Year Title
26676784 2015 Human MicroRNA miR-532-5p Exhibits Antiviral Activity against West Nile Virus via Suppression of Host Genes SESTD1 and TAB3 Required for Virus Replication.
26555189 2015 MiR-30a attenuates immunosuppressive functions of IL-1?-elicited mesenchymal stem cells via targeting TAB3.
25416956 2014 A proteome-scale map of the human interactome network.
24565101 2014 MicroRNA-26b suppresses the NF-?B signaling and enhances the chemosensitivity of hepatocellular carcinoma cells by targeting TAK1 and TAB3.
24434549 2014 TRIM38 inhibits TNF?- and IL-1?-triggered NF-?B activation by mediating lysosome-dependent degradation of TAB2/3.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23286385 2013 Identification of proteins that interact with TANK binding kinase 1 and testing for mutations associated with glaucoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22660635 2012 The microRNA miR-23b suppresses IL-17-associated autoimmune inflammation by targeting TAB2, TAB3 and IKK-?.
22158122 2011 Cysteine methylation disrupts ubiquitin-chain sensing in NF-?B activation.
More...