Property Summary

NCBI Gene PubMed Count 2
PubMed Score 1.03
PubTator Score 0.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

AA Sequence

MSLNPPIFLKRSEENSSKFVETKQSQTTSIASEDPLQNLCLASQEVLQKAQQSGRSKCLKCGGSRMFYCY      1 - 70
TCYVPVENVPIEQIPLVKLPLKIDIIKHPNETDGKSTAIHAKLLAPEFVNIYTYPCIPEYEEKDHEVALI     71 - 140
FPGPQSISIKDISFHLQKRIQNNVRGKNDDPDKPSFKRKRTEEQEFCDLNDSKCKGTTLKKIIFIDSTWN    141 - 210
QTNKIFTDERLQGLLQVELKTRKTCFWRHQKGKPDTFLSTIEAIYYFLVDYHTDILKEKYRGQYDNLLFF    211 - 280
YSFMYQLIKNAKCSGDKETGKLTH                                                  281 - 304
//

Text Mined References (5)

PMID Year Title
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22041458 2012 Pharmacogenomic study of side-effects for antidepressant treatment options in STAR*D.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.