Property Summary

NCBI Gene PubMed Count 2
PubMed Score 1.03
PubTator Score 0.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 2.55719295243814E-7
osteosarcoma 7933 5.13094077521443E-6
sonic hedgehog group medulloblastoma 1482 1.37080283173388E-5
glioblastoma 5572 1.74854361799907E-5
pilocytic astrocytoma 3086 2.79444106200657E-5
atypical teratoid / rhabdoid tumor 4369 5.63002391112101E-5
adult high grade glioma 2148 9.03118966361562E-5
ependymoma 2514 2.73992446928329E-4
medulloblastoma, large-cell 6234 0.00150018259730954
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00191507912517301
primitive neuroectodermal tumor 3031 0.00462384071869172
astrocytic glioma 2241 0.00666028587853399
oligodendroglioma 2849 0.0169408929620179
Disease Target Count Z-score Confidence
Mental depression 58 0.0 1.0

Expression

  Differential Expression (13)

Synonym

Accession Q8N5C7 Q567Q3 Q8WVG9 Q9NRU6
Symbols MDS009

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG
Fruitfly EggNOG Inparanoid

AA Sequence

MSLNPPIFLKRSEENSSKFVETKQSQTTSIASEDPLQNLCLASQEVLQKAQQSGRSKCLKCGGSRMFYCY      1 - 70
TCYVPVENVPIEQIPLVKLPLKIDIIKHPNETDGKSTAIHAKLLAPEFVNIYTYPCIPEYEEKDHEVALI     71 - 140
FPGPQSISIKDISFHLQKRIQNNVRGKNDDPDKPSFKRKRTEEQEFCDLNDSKCKGTTLKKIIFIDSTWN    141 - 210
QTNKIFTDERLQGLLQVELKTRKTCFWRHQKGKPDTFLSTIEAIYYFLVDYHTDILKEKYRGQYDNLLFF    211 - 280
YSFMYQLIKNAKCSGDKETGKLTH                                                  281 - 304
//

Text Mined References (5)

PMID Year Title
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22041458 2012 Pharmacogenomic study of side-effects for antidepressant treatment options in STAR*D.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.