Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.63
PubTator Score 3.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Glaucoma 239 4.342 2.2
Disease Target Count Z-score Confidence
Optic nerve disease 10 3.082 1.5

Expression

  Differential Expression (8)

Disease log2 FC p
Astrocytoma, Pilocytic 1.200 1.9e-05
Breast cancer 2.600 4.0e-02
ependymoma 1.200 1.3e-07
glioblastoma 1.300 6.0e-08
group 3 medulloblastoma 1.400 3.2e-04
ovarian cancer 1.100 4.1e-03
pediatric high grade glioma 1.100 2.0e-06
primitive neuroectodermal tumor 1.200 1.6e-05

Gene RIF (6)

AA Sequence

MSSLPRRAKVQVQDVVLKDEFSSFSELSSASEEDDKEDSAWEPQKKVPRSRKQPPPKESKPKRMPRVKKN      1 - 70
APQISDGSEVVVVKEELNSSVAIADTALEDRKNKLDTVQTLKTAKTKQKCAAQPHTVRRTKKLKVEEETS     71 - 140
KASNLEGESNSSETPSTSTVWGGTCKKEENDDDFTFGQSALKKIKTETYPQGQPVKFPANANSTKEEVEM    141 - 210
NWDMVQVLSERTNIEPWVCANIIRLFNDDNTIPFIIRYRKELINNLDADSLREVQQTLEELRAVAKKVHS    211 - 280
TIQKIKKEGKMSECLLKAMLNCKTFEELEHVSAPYKTGSKGTKAQRARQLGLEGAARALLEKPGELSLLS    281 - 350
YIRPDVKGLSTLQDIEIGVQHILADMIAKDKDTLDFIRNLCQKRHVCIQSSLAKVSSKKVNEKDVDKFLL    351 - 420
YQHFSCNIRNIHHHQILAINRGENLKVLTVKVNISDGVKDEFCRWCIQNRWRPRSFARPELMKILYNSLN    421 - 490
DSFKRLIYPLLCREFRAKLTSDAEKESVMMFGRNLRQLLLTSPVPGRTLMGVDPGYKHGCKLAIISPTSQ    491 - 560
ILHTDVVYLHCGQGFREAEKIKTLLLNFNCSTVVIGNGTACRETEAYFADLIMKNYFAPLDVVYCIVSEA    561 - 630
GASIYSVSPEANKEMPGLDPNLRSAVSIARRVQDPLAELVKIEPKHIGVGMYQHDVSQTLLKATLDSVVE    631 - 700
ECVSFVGVDINICSEVLLRHIAGLNANRAKNIIEWREKNGPFINREQLKKVKGLGPKSFQQCAGFIRINQ    701 - 770
DYIRTFCSQQTETSGQIQGVAVTSSADVEVTNEKQGKKKSKTAVNVLLKPNPLDQTCIHPESYDIAMRFL    771 - 840
SSIGGTLYEVGKPEMQQKINSFLEKEGMEKIAERLQTTVHTLQVIIDGLSQPESFDFRTDFDKPDFKRSI    841 - 910
VCLEDLQIGTVLTGKVENATLFGIFVDIGVGKSGLIPIRNVTEAKLSKTKKRRSLGLGPGERVEVQVLNI    911 - 980
DIPRSRITLDLIRVL                                                           981 - 995
//

Text Mined References (18)

PMID Year Title