Property Summary

NCBI Gene PubMed Count 17
PubMed Score 19.73
PubTator Score 16.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (4)

Disease log2 FC p
ependymoma -1.400 6.6e-07
glioblastoma -1.100 5.3e-04
ovarian cancer -1.200 5.7e-07
pancreatic cancer 1.100 1.2e-02

 GWAS Trait (1)

Gene RIF (8)

AA Sequence

MATAAQGPLSLLWGWLWSERFWLPENVSWADLEGPADGYGYPRGRHILSVFPLAAGIFFVRLLFERFIAK      1 - 70
PCALCIGIEDSGPYQAQPNAILEKVFISITKYPDKKRLEGLSKQLDWNVRKIQCWFRHRRNQDKPPTLTK     71 - 140
FCESMWRFTFYLCIFCYGIRFLWSSPWFWDIRQCWHNYPFQPLSSGLYHYYIMELAFYWSLMFSQFTDIK    141 - 210
RKDFLIMFVHHLVTIGLISFSYINNMVRVGTLIMCLHDVSDFLLEAAKLANYAKYQRLCDTLFVIFSAVF    211 - 280
MVTRLGIYPFWILNTTLFESWEIIGPYASWWLLNGLLLTLQLLHVIWSYLIARIALKALIRGKVSKDDRS    281 - 350
DVESSSEEEDVTTCTKSPCDSSSSNGANRVNGHMGGSYWAEE                                351 - 392
//

Text Mined References (18)

PMID Year Title