Property Summary

NCBI Gene PubMed Count 22
Grant Count 69
R01 Count 27
Funding $7,333,165.12
PubMed Score 2.77
PubTator Score 7.18

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8N5A5 E1P5K1 Q4VXN9 Q5JWI9 Q5JWJ0 Q8NC55 Q8WUV4 Q96JI0 Q96JU4 Q9H401
Symbols ZIP
ZC3H9
GPATC6
GPATCH6
ZC3HDC9
KIAA1847

Gene

PDB

4II1  

Gene RIF (6)

PMID Text
24116224 HIV-1 Vpr induces the degradation of ZIP/sZIP through the DCAF1 ubiquitin ligase, while VprQ65R mutant impairs the Vpr-induced degradation of ZIP/sZIP
24116224 HIV-1 Vpr induces the degradation of ZIP/sZIP through the DCAF1 ubiquitin ligase, while VprQ65R mutant impairs the Vpr-induced degradation of ZIP/sZIP
20549515 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20233718 sZIP, an alternative splice variant of ZIP, antagonizes transcription repression and growth inhibition by ZIP in liver neoplasms.
19623168 Observational study of gene-disease association. (HuGE Navigator)
18854154 Knockdown of zinc finger, CCCH-type with G patch domain (ZGPAT) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1

AA Sequence

MDEESLESALQTYRAQLQQVELALGAGLDSSEQADLRQLQGDLKELIELTEASLVSVRKSSLLAALDEER      1 - 70
PGRQEDAEYQAFREAITEAVEAPAAARGSGSETVPKAEAGPESAAGGQEEEEGEDEEELSGTKVSAPYYS     71 - 140
SWGTLEYHNAMVVGTEEAEDGSAGVRVLYLYPTHKSLKPCPFFLEGKCRFKENCRFSHGQVVSLDELRPF    141 - 210
QDPDLSSLQAGSACLAKHQDGLWHAARITDVDNGYYTVKFDSLLLREAVVEGDGILPPLRTEATESDSDS    211 - 280
DGTGDSSYARVVGSDAVDSAQSSALCPSLAVVGSDAVDSGTCSSAFAGWEVHTRGIGSRLLTKMGYEFGK    281 - 350
GLGRHAEGRVEPIHAVVLPRGKSLDQCVETLQKQTRVGKAGTNKPPRCRGRGARPGGRPAPRNVFDFLNE    351 - 420
KLQGQAPGALEAGAAPAGRRSKDMYHASKSAKRALSLRLFQTEEKIERTQRDIRSIQEALARNAGRHSVA    421 - 490
SAQLQEKLAGAQRQLGQLRAQEAGLQQEQRKADTHKKMTEF                                 491 - 531
//

Text Mined References (25)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25416956 2014 A proteome-scale map of the human interactome network.
24116224 2013 HIV-1 Vpr induces the degradation of ZIP and sZIP, adaptors of the NuRD chromatin remodeling complex, by hijacking DCAF1/VprBP.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21297633 2011 Meta-analysis identifies 29 additional ulcerative colitis risk loci, increasing the number of confirmed associations to 47.
21269460 2011 Initial characterization of the human central proteome.
21102463 2010 Genome-wide meta-analysis increases to 71 the number of confirmed Crohn's disease susceptibility loci.
More...