Property Summary

NCBI Gene PubMed Count 1
PubMed Score 4.93
PubTator Score 2.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
tuberculosis 2010 4.9e-09
ulcerative colitis 1819 1.1e-07
ovarian cancer 8520 4.3e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Obstructive sleep apnea 26 3.071 1.5

Expression

  Differential Expression (3)

Disease log2 FC p
ovarian cancer 1.300 4.3e-05
tuberculosis 2.100 4.9e-09
ulcerative colitis -1.400 1.1e-07

AA Sequence

MAAPEPLSPAGGAGEEAPEEDEDEAEAEDPERPNAGAGGGRSGGGGSSVSGGGGGGGAGAGGCGGPGGAL      1 - 70
TRRAVTLRVLLKDALLEPGAGVLSIYYLGKKFLGDLQPDGRIMWQETGQTFNSPSAWATHCKKLVNPAKK     71 - 140
SGCGWASVKYKGQKLDKYKATWLRLHQLHTPATAADESPASEGEEEELLMEEEEEDVLAGVSAEDKSRRP    141 - 210
LGKSPSEPAHPEATTPGKRVDSKIRVPVRYCMLGSRDLARNPHTLVEVTSFAAINKFQPFNVAVSSNVLF    211 - 280
LLDFHSHLTRSEVVGYLGGRWDVNSQMLTVLRAFPCRSRLGDAETAAAIEEEIYQSLFLRGLSLVGWYHS    281 - 350
HPHSPALPSLQDIDAQMDYQLRLQGSSNGFQPCLALLCSPYYSGNPGPESKISPFWVMPPPEMLLVEFYK    351 - 420
GSPDLVRLQEPWSQEHTYLDKLKISLASRTPKDQSLCHVLEQVCGVLKQGS                       421 - 471
//

Text Mined References (7)

PMID Year Title