Property Summary

NCBI Gene PubMed Count 17
PubMed Score 44.99
PubTator Score 14.60

Knowledge Summary


No data available


  Disease Sources (2)

Disease Target Count P-value
oligodendroglioma 2849 4.48325723005883E-11
medulloblastoma, large-cell 6234 3.16815690049271E-5
medulloblastoma 1524 3.3340197490149E-5
ulcerative colitis 2087 5.33112858206025E-5
lung cancer 4473 8.5710849864785E-5
lung adenocarcinoma 2714 1.71899910556816E-4
glioblastoma 5572 2.50585159671695E-4
atypical teratoid / rhabdoid tumor 4369 5.91781981931609E-4
primitive neuroectodermal tumor 3031 6.32525460908658E-4
psoriasis 6685 7.96027514859495E-4
osteosarcoma 7933 0.00175435062143455
Atopic dermatitis 944 0.00216103434469596
ovarian cancer 8492 0.00499822210988986
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00639527307495171
ependymoma 2514 0.00663989662273768
Parkinson's disease 364 0.00790653942489597
astrocytoma 1493 0.0196227377948153
Pick disease 1893 0.0308757336209398
adult high grade glioma 2148 0.042132699796546
Disease Target Count Z-score Confidence
Narcolepsy 69 3.644 1.8


  Differential Expression (19)

Disease log2 FC p
astrocytoma -1.300 0.020
ependymoma -1.500 0.007
psoriasis -1.300 0.001
glioblastoma -1.800 0.000
oligodendroglioma -1.200 0.000
osteosarcoma 1.431 0.002
medulloblastoma -1.800 0.000
atypical teratoid / rhabdoid tumor -2.500 0.001
medulloblastoma, large-cell -2.600 0.000
primitive neuroectodermal tumor -1.700 0.001
Atopic dermatitis -1.100 0.002
intraductal papillary-mucinous adenoma (... 1.700 0.006
lung cancer 3.700 0.000
Parkinson's disease -2.100 0.008
adult high grade glioma -1.200 0.042
lung adenocarcinoma 1.149 0.000
Pick disease -1.100 0.031
ulcerative colitis -1.600 0.000
ovarian cancer 1.600 0.005



  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG
C. elegans OMA Inparanoid

Gene RIF (7)

26616534 OXR1 may act as a sensor of cellular oxidative stress to regulate the transcriptional networks required to detoxify reactive oxygen species and modulate cell cycle and apoptosis.
25792726 Oxr1 serves as a potential therapeutic target for ALS and other neurodegenerative disorders characterized by TDP-43 or FUS pathology.
25236744 OXR1 upregulates the expression of antioxidant genes via the p21 signaling pathway to suppress hydrogen peroxide-induced oxidative stress and maintain mtDNA integrity.
22873401 The protein segment encoded by exon 8 plays an important role in the anti-oxidative function of the human OXR1 protein.
20877624 Observational study of gene-disease association. (HuGE Navigator)
17391516 human OXR1 is capable of reducing the DNA damaging effects of reactive oxygen species when expressed in bacteria, indicating the protein has an activity that can contribute to oxidation resistance.
15060142 Data show that human and yeast oxidation resistance 1 (OXR1) genes are induced by heat and oxidative stress and that their proteins localize to the mitochondria and function to protect against oxidative damage.

AA Sequence

LYHGRSHSCKTFGNRTLSKKEDFFIQDIEIWAFE                                        841 - 874

Text Mined References (27)

PMID Year Title
26616534 2015 Transcriptome analysis of human OXR1 depleted cells reveals its role in regulating the p53 signaling pathway.
25792726 2015 Oxr1 improves pathogenic cellular features of ALS-associated FUS and TDP-43 mutations.
25416956 2014 A proteome-scale map of the human interactome network.
25236744 2014 Human OXR1 maintains mitochondrial DNA integrity and counteracts hydrogen peroxide-induced oxidative stress by regulating antioxidant pathways involving p21.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22873401 2012 Structural/functional analysis of the human OXR1 protein: identification of exon 8 as the anti-oxidant encoding function.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17516841 2007 Mid-region parathyroid hormone-related protein (PTHrP) and gene expression of MDA-MB231 breast cancer cells.
17391516 2007 The OXR domain defines a conserved family of eukaryotic oxidation resistance proteins.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15060142 2004 Stress induction and mitochondrial localization of Oxr1 proteins in yeast and humans.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12880961 2003 Neuroblastoma oligo-capping cDNA project: toward the understanding of the genesis and biology of neuroblastoma.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11114193 2000 Functional genomics reveals a family of eukaryotic oxidation protection genes.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.