Property Summary

NCBI Gene PubMed Count 17
Grant Count 7
R01 Count 4
Funding $745,715.91
PubMed Score 44.99
PubTator Score 14.60

Knowledge Summary


No data available


  Differential Expression (19)

Disease log2 FC p
astrocytoma -1.300 0.020
ependymoma -1.500 0.007
psoriasis -1.300 0.001
glioblastoma -1.800 0.000
oligodendroglioma -1.200 0.000
osteosarcoma 1.431 0.002
medulloblastoma -1.800 0.000
atypical teratoid / rhabdoid tumor -2.500 0.001
medulloblastoma, large-cell -2.600 0.000
primitive neuroectodermal tumor -1.700 0.001
Atopic dermatitis -1.100 0.002
intraductal papillary-mucinous adenoma (... 1.700 0.006
lung cancer 3.700 0.000
Parkinson's disease -2.100 0.008
adult high grade glioma -1.200 0.042
lung adenocarcinoma 1.149 0.000
Pick disease -1.100 0.031
ulcerative colitis -1.600 0.000
ovarian cancer 1.600 0.005

Gene RIF (7)

26616534 OXR1 may act as a sensor of cellular oxidative stress to regulate the transcriptional networks required to detoxify reactive oxygen species and modulate cell cycle and apoptosis.
25792726 Oxr1 serves as a potential therapeutic target for ALS and other neurodegenerative disorders characterized by TDP-43 or FUS pathology.
25236744 OXR1 upregulates the expression of antioxidant genes via the p21 signaling pathway to suppress hydrogen peroxide-induced oxidative stress and maintain mtDNA integrity.
22873401 The protein segment encoded by exon 8 plays an important role in the anti-oxidative function of the human OXR1 protein.
20877624 Observational study of gene-disease association. (HuGE Navigator)
17391516 human OXR1 is capable of reducing the DNA damaging effects of reactive oxygen species when expressed in bacteria, indicating the protein has an activity that can contribute to oxidation resistance.
15060142 Data show that human and yeast oxidation resistance 1 (OXR1) genes are induced by heat and oxidative stress and that their proteins localize to the mitochondria and function to protect against oxidative damage.

AA Sequence

LYHGRSHSCKTFGNRTLSKKEDFFIQDIEIWAFE                                        841 - 874

Text Mined References (27)

PMID Year Title
26616534 2015 Transcriptome analysis of human OXR1 depleted cells reveals its role in regulating the p53 signaling pathway.
25792726 2015 Oxr1 improves pathogenic cellular features of ALS-associated FUS and TDP-43 mutations.
25416956 2014 A proteome-scale map of the human interactome network.
25236744 2014 Human OXR1 maintains mitochondrial DNA integrity and counteracts hydrogen peroxide-induced oxidative stress by regulating antioxidant pathways involving p21.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22873401 2012 Structural/functional analysis of the human OXR1 protein: identification of exon 8 as the anti-oxidant encoding function.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.