Property Summary

NCBI Gene PubMed Count 17
PubMed Score 49.44
PubTator Score 14.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adult high grade glioma -1.200 4.2e-02
astrocytic glioma -1.200 1.6e-02
Atopic dermatitis -1.100 2.2e-03
atypical teratoid / rhabdoid tumor -2.500 5.9e-04
ependymoma -1.500 6.6e-03
glioblastoma -1.300 1.8e-02
group 3 medulloblastoma -1.700 3.4e-02
intraductal papillary-mucinous adenoma (... 1.700 6.4e-03
lung adenocarcinoma 1.149 1.7e-04
lung cancer 3.700 8.6e-05
medulloblastoma, large-cell -2.600 3.2e-05
oligodendroglioma -1.200 4.5e-11
osteosarcoma 1.431 1.8e-03
ovarian cancer 1.600 5.0e-03
Parkinson's disease -2.100 7.9e-03
Pick disease -1.100 3.1e-02
primitive neuroectodermal tumor -1.500 5.2e-03
psoriasis -1.300 8.0e-04
ulcerative colitis -1.300 1.1e-06

Gene RIF (7)

AA Sequence

MTKDKNSPGLKKKSQSVDINAPGFNPLAGAGKQTPQASKPPAPKTPIIEEEQNNAANTQKHPSRRSELKR      1 - 70
FYTIDTGQKKTLDKKDGRRMSFQKPKGTIEYTVESRDSLNSIALKFDTTPNELVQLNKLFSRAVVTGQVL     71 - 140
YVPDPEYVSSVESSPSLSPVSPLSPTSSEAEFDKTTNPDVHPTEATPSSTFTGIRPARVVSSTSEEEEAF    141 - 210
TEKFLKINCKYITSGKGTVSGVLLVTPNNIMFDPHKNDPLVQENGCEEYGIMCPMEEVMSAAMYKEILDS    211 - 280
KIKESLPIDIDQLSGRDFCHSKKMTGSNTEEIDSRIRDAGNDSASTAPRSTEESLSEDVFTESELSPIRE    281 - 350
ELVSSDELRQDKSSGASSESVQTVNQAEVESLTVKSESTGTPGHLRSDTEHSTNEVGTLCHKTDLNNLEM    351 - 420
AIKEDQIADNFQGISGPKEDSTSIKGNSDQDSFLHENSLHQEESQKENMPCGETAEFKQKQSVNKGKQGK    421 - 490
EQNQDSQTEAEELRKLWKTHTMQQTKQQRENIQQVSQKEAKHKITSADGHIESSALLKEKQRHRLHKFLC    491 - 560
LRVGKPMRKTFVSQASATMQQYAQRDKKHEYWFAVPQERTDHLYAFFIQWSPEIYAEDTGEYTREPGFIV    561 - 630
VKKIEESETIEDSSNQAAAREWEVVSVAEYHRRIDALNTEELRTLCRRLQITTREDINSKQVATVKADLE    631 - 700
SESFRPNLSDPSELLLPDQIEKLTKHLPPRTIGYPWTLVYGTGKHGTSLKTLYRTMTGLDTPVLMVIKDS    701 - 770
DGQVFGALASEPLKVSDGFYGTGETFVFTFCPEFEVFKWTGDNMFFIKGDMDSLAFGGGGGEFALWLDGD    771 - 840
LYHGRSHSCKTFGNRTLSKKEDFFIQDIEIWAFE                                        841 - 874
//

Text Mined References (27)

PMID Year Title