Property Summary

NCBI Gene PubMed Count 11
PubMed Score 6.92
PubTator Score 6.51

Knowledge Summary

Patent (98,302)

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0055614699918335
oligodendroglioma 2849 0.00746385912258289
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0126013606992847
astrocytic glioma 2241 0.0245580792221703
Disease Target Count Z-score Confidence
Lissencephaly 61 3.425 1.7
Quadriplegia 14 3.065 1.5

Expression

  Differential Expression (4)

Synonym

Accession Q8N568 C9J5Q9 Q59GC8 Q8N399
Symbols CL2
DCK2
CLIK2
DCDC3
CLICK2
DCDC3B
DCAMKL2
CLICK-II

Gene

  Ortholog (11)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Platypus OMA Inparanoid
Anole lizard OMA Inparanoid
C. elegans OMA Inparanoid
Fruitfly OMA Inparanoid

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

AA Sequence

MASTRSIELEHFEERDKRPRPGSRRGAPSSSGGSSSSGPKGNGLIPSPAHSAHCSFYRTRTLQALSSEKK      1 - 70
AKKARFYRNGDRYFKGLVFAISSDRFRSFDALLIELTRSLSDNVNLPQGVRTIYTIDGSRKVTSLDELLE     71 - 140
GESYVCASNEPFRKVDYTKNINPNWSVNIKGGTSRALAAASSVKSEVKESKDFIKPKLVTVIRSGVKPRK    141 - 210
AVRILLNKKTAHSFEQVLTDITEAIKLDSGVVKRLCTLDGKQVTCLQDFFGDDDVFIACGPEKFRYAQDD    211 - 280
FVLDHSECRVLKSSYSRSSAVKYSGSKSPGPSRRSKSPASVNGTPSSQLSTPKSTKSSSSSPTSPGSFRG    281 - 350
LKQISAHGRSSSNVNGGPELDRCISPEGVNGNRCSESSTLLEKYKIGKVIGDGNFAVVKECIDRSTGKEF    351 - 420
ALKIIDKAKCCGKEHLIENEVSILRRVKHPNIIMLVEEMETATELFLVMELVKGGDLFDAITSSTKYTER    421 - 490
DGSAMVYNLANALRYLHGLSIVHRDIKPENLLVCEYPDGTKSLKLGDFGLATVVEGPLYTVCGTPTYVAP    491 - 560
EIIAETGYGLKVDIWAAGVITYILLCGFPPFRSENNLQEDLFDQILAGKLEFPAPYWDNITDSAKELISQ    561 - 630
MLQVNVEARCTAGQILSHPWVSDDASQENNMQAEVTGKLKQHFNNALPKQNSTTTGVSVIMNTALDKEGQ    631 - 700
IFCSKHCQDSGRPGMEPISPVPPSVEEIPVPGEAVPAPTPPESPTPHPPPAAPGGERAGTWRRHRD        701 - 766
//

Text Mined References (16)

PMID Year Title
25512093 2015 Novel mutations in the DYNC1H1 tail domain refine the genetic and clinical spectrum of dyneinopathies.
24133439 2013 Genome-wide association study of autistic-like traits in a general population study of young adults.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
20236041 2010 The doublecortin gene family and disorders of neuronal structure.
19342486 2009 Mice lacking doublecortin and doublecortin-like kinase 2 display altered hippocampal neuronal maturation and spontaneous seizures.
18618084 2008 Gene trapping: an antibody-dependent approach for verifying integration in your favorite gene.
18075264 2008 Alternative transcripts of Dclk1 and Dclk2 and their expression in doublecortin knockout mice.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
More...